Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17400-AT1G72490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.53448095136702
Log2 mRNA fold difference:1.7725326236194
Log2 TE fold difference:-0.82999046633854
Sequences
Protein sequence

MKFFGWMQNKLNGDHNRTSTSSASSHHVKQEPREEFSDWPHALLAIGTFGTTSNSVSENE
SKNVHEEIEAEKKCTAQSEQEEEPSSSVNLEDFTPEEVGKLQKELMKLLSRTKKRKSDVN
RELMKNLPLDRFLNCPSSLEVDRRISNALSAVVDSSEENKEEDMERTINVILGRCKEISI
ESKNNKKKRDISKNSVSYLFKKIFVCADGISTAPSPSLRDTLQESRMEKLLKMMLHKKIN
AQASSKPTSLTTKRYLQDKKQLSLKSEEEETSERRSSSDGYKWVKTDSDFIVLEI

MKFFGWMQNKLHGKQEITHRPSISSASSHHPREEFNDWPHGLLAIGTFGNKKQTPQTLDQ
EVIQEETVSNLHVEGRQAQDTDQELSSSDDLEEDFTPEEVGKLQKELTKLLTRRSKKRKS
DVNRELANLPLDRFLNCPSSLEVDRRISNALCDEKEEDIERTISVILGRCKAISTESKNK
TKKNKRDLSKTSVSHLLKKMFVCTEGFSPVPRPILRDTFQETRMEKLLRMMLHKKVNTQA
SSKQTSTKKYLQDKQQLSLKNEEEEGRSSNDGGKWVKTDSDFIVLEI

Other information
Ka divergence:0.00497773KaKs divergence:-0.347331
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):888Length 2 (bp):864Length divergence:-0.014
MFE 1 (kcal):-247.52MFE 2 (kcal):-239.24MFE divergence-0.017