Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17420-AT1G72520
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):lipoxygenase 3
Function (paralog2):PLAT/LH2 domain-containing lipoxygenase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.1929603353293
Log2 mRNA fold difference:-1.5942414542254
Log2 TE fold difference:-1.1266738669584
Sequences
Protein sequence

MALAKELMGYPLITERSSLVSSASHFKKRTQSTQFSINPFDRRPRKTKSGVVAAISEDLV
KTLRFSTTTGDRKSEEEEKAAVKFKVRAVVTVRNKNKEDLKETLVKHLDAFADKIGRNIV
LELISTQLDPKTKLPKKSNAAVLKDWSKKSKTKAERVHYTAEFTVDAAFGSPGAITVMNK
HQKEFFLESITIEGFALGPVHFPCNSWVQSQKDHPDKRIFFTNQPYLPNETPSGLRVLRE
KELKNLRGDGSGVRKLSDRIYDFDVYNDLGNPDKSSELSRPKLGGKEVPYPRRCRTGRQS
TVSDKDAESRVEKPLPMYVPRDEQFEESKQDTFAAGRLKAVLHHLIPSLKASIVAEDFAD
FGEIDRLYKEGLLLKLGFQDDIFKKFPLPKVVVDTLQESTKGLLKYDTPKILSKDKNAWL
RDDEFARQAIAGINPVNIERVKTFPPVSNLDPKIYGPQHSALTDDHIIGHLDGFSVQQAL
EENRLYMLDYHDIFLPFLDRINALDGRKAYATRTIFFLTRLGTLKPVAIELSLPPHGPKH
RSKRVLTPPVDATSNWMWQLAKAHVSSNDAGVHQLVNHWLRTHACLEPFILAAHRQLSAM
HPIFKLLDPHMRYTLEINALARQSLISADGVIEGGFTAGAYGMEMSAAAYKSSWRFDMEG
LPADLIRRGMAIPDATQPHGLKLLIEDYPYANDGLLLWSAIQTWVRTYVERYYPNPNLIK
TDSELQSWYSESINVGHADLRDADWWPELSTVDDLVSILTTLIWLASAQHAALNFGQYPY
GGYVPNRPPLMRRLIPDESDPEYASFISHPEKYYFSSMPSLAQTSKFMAVVDTLSTHSPD
EEYIGERQQPSIWTGDAEIVEAFYGFAAEIGRIEKEIEKRNADPDRRNRCGAGVLPYELL
VPSSEPGVTCRGVPNSVSI

MALANEIMGSRLIFERSSSLASPFHSRFSIKKKTQRTQFSINPFDPRPMRAVNSSGVVAA
ISEDLVKTLRISTVGRKQEKEEEEEKSVKFKVRAVATVRNKNKEDFKETLVKHLDAFTDK
IGRNVVLELMSTQVDPKTNEPKKSKAAVLKDWSKKSNSKAERVHYTAEFTVDSAFGSPGA
ITVTNKHQKEFFLESITIEGFACGPVHFPCNSWVQSQKDHPSKRILFTNQPYLPSETPSG
LRTLREKELENLRGNGKGERKLSDRIYDYDVYNDIGNPDISRELARPTLGGREFPYPRRC
RTGRSSTDTDMMSERRVEKPLPMYVPRDEQFEESKQNTFAACRLKAVLHNLIPSLKASIL
AEDFANFGEIDSLYKEGLLLKLGFQDDMFKKFPLPKIVTTLQKSSEGLLRYDTPKIVSKD
KYAWLRDDEFARQAIAGINPVNIERVTSYPPVSNLDPEIYGPGLHSALTEDHIIGQLDGL
TVQQALETNRLFMVDYHDIYLPFLDRINALDGRKAYATRTILFLTRLGTLKPIAIELSLP
SQSSSNQKSKRVVTPPVDATSNWMWQLAKAHVGSNDAGVHQLVNHWLRTHACLEPFILAA
HRQLSAMHPIFKLLDPHMRYTLEINAVARQTLISADGVIESCFTAGQYGLEISSAAYKNK
WRFDMEGLPADLIRRGMAVPDPTQPHGLKLLVEDYPYANDGLLLWSAIQTWVRTYVERYY
ANSNLIQTDTELQAWYSESINVGHADHRDAEWWPKLSTVEDLVSVITTIIWLASAQHAAL
NFGQYPYGGYVPNRPPLMRRLIPDESDPEFTSFIEDPQKYFFSSMPSLLQTTKFMAVVDT
LSTHSPDEEYIGERQQPSIWTGDAEIVDAFYGFSAEIGRIEKEIDKRNRDPSRRNRCGAG
VLPYELMAPSSEPGVTCRGVPNSVSI

Other information
Ka divergence:0.100056KaKs divergence:-0.14439
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):2760Length 2 (bp):2781Length divergence:0.004
MFE 1 (kcal):-866.73MFE 2 (kcal):-857.82MFE divergence-0.005