Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17430-AT1G72620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.0954865257976
Log2 mRNA fold difference:-2.7304548172087
Log2 TE fold difference:-0.090034047720834
Sequences
Protein sequence

MASMKHVHLFRRYLSIVFTLFQRLISCFFDFPILIKIADSFLSLYFLVFCDLRPVTVDLD
DGETTVHFWISGHRRISRQNLVMLHGYGGNSKWQFVHQVSDLSKSFNLFIPDLVFFGKSY
SKNRDRSVEIQARSVVGGLKKLGCVEGGGGISIYSISYGGFVAYKMAEIWPAMVEKLVIV
SSGVGFTQQQKTAELKKHGGDCSKILVPKTPMDLRLLIKISMNTGLTFVDWVPDFFLSQF
IAVMYEKNRQELLELAKNLLEREEEPELPVISQKTLIVWGDKDKVFPLEHAYRLQRHLQS
SRLEIIKETGHAVNIEAPTTLNNFITSFVLSA

MVSMKSFVHILRRYISIAITLFYNLIWCLFDNFDYPILIKLADTFLSLYFLIFCDLRPIT
VDLNDGETTLHFWISGHRKINRPNLVMLHGYGGNSKWQFIHQVSDLSKSFNLFIPDLVFF
GKSYSRNTDRTIEFQARSIVGGLKRLGCGDGDLSVYSISYGGFVAYRIAKIWPEMIEKLV
IVSSGVGFTQQQKMTEMKKHGGDVSEILVPSNPRDLRLLVKVSMNTGIRFLDWVPDFILS
QFIAVMYETNRQELVDLAKNLLEREEEPELFSISQRTLIVWGDKDNVFPLEHGRRLQRHL
PNSSLEVLKEIGHGVNIEAPTTLNNLIISFVLGVP

www.000webhost.com

Other information
Ka divergence:0.0810615KaKs divergence:-0.197858
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):999Length 2 (bp):1008Length divergence:0.004
MFE 1 (kcal):-301.58MFE 2 (kcal):-295.62MFE divergence-0.01