Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17455-AT1G72630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ELF4-like 4
Function (paralog2):ELF4-like 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.8619615911478
Log2 mRNA fold difference:0.64717892285758
Log2 TE fold difference:1.3175218125503
Sequences
Protein sequence

MEGDVLSGFGDRHNMDGKLLQSFQKSFVDVQDILDQNRLLINEINQNHESKQPDNLGRNV
GLIKELNNNIRRVASLYGDLSHSFARSVDASSEGESSGTLKSDGKANQKRFRSG

MESRMEGDVYSGFGERYQMDGKLLQNFQKSFVQVQDILDQNRLLINEINQNHESKQADHL
GRNVGLIRELNNNIRTVASLYGDLSHSFARSVDASSEGESTGTLKSDGKANNQKRFRSG

Other information
Ka divergence:0.231492KaKs divergence:-0.0603448
GC content 1 (%):40GC content 2 (%):40GC content divergence:0
Length 1 (bp):345Length 2 (bp):360Length divergence:0.021
MFE 1 (kcal):-88.6MFE 2 (kcal):-92.9MFE divergence0.024