Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17460-AT1G72650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TRF-like 3
Function (paralog2):TRF-like 6

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.5982804752521
Log2 mRNA fold difference:3.0800434337304
Log2 TE fold difference:-0.36592971346279
Sequences
Protein sequence

MFGNVKDYGETFQDSIFQTRNGSLSSTNQIGNPVTYKLVRVAGDGSLVPATDEEMLEVKN
LLEKNEQDMPVLPDPIQTEEYIPDEGSPSQFLQLENFEGKTYCIHAKTDRISLGLHDKGF
FQSETAGPYTENLNSRHESKEELMNGSQMLFVLPDTKFQISTELSGNVELVPSKVLLQEP
ILFSSNGCSINQSTDVLNATASPKEPALSTAASKPDFSRVPGEISLANLSIKELQETFRA
TFGRETTSKDKRWLKRRIKMGLINSCVVPTTTLTINDSKLIGGDQDAIDAFSKGTVDEET
ATESIDTPASPDGIKGHSNDFGHSPVETFVDHYSGNEDFEGEDGSAKRVRKPTRRYIEET
NEKQQIDGSMIPSKDPSSIQAVSSEGRVVVTRMVSLAGSRIQVPYVSHVRRSRPRENIMA
LGEFRSKSWEVKAAPEEGNLNLSPPQLSNDVNRVPGVKSASRCVQKESDKDHLKPIFTDV
DQEMMEPELLDSSGDSSDDNFVDAPITQSASGRKLHRAWTISEVEKLVEGVSKYGVGKWT
EIKKLSFSPYTHRTTVDLKDKWRNLQKASSSNRMEGGLKKHGSMAIPTHIMLQVRELAQK
QSPISRVVSKARVVKRSRSRNGFL

MGTVVGTVEDRRDMFEGNAQTRITPFSSTNQIGNPVAYKLVRVSGDGSLVPATDEEILEV
NDTDMHIPSDTCQTIGYLATDEENVEVDETDMHIASDACQTIGYLPAEGIPSRLSQIESS
EAINSGLLHSDNVQPYTDQVKSRSEYNEEMLQKVEQEERLENVHGSQMPSTPADANIQCS
NENNFFEEDQVHHEALLQDECKMNESDMMERCSNAVASPKETALSAAAQKPDFSRVRGEI
CLDNLPIKALQETFRATFGRDTTVKDKTWLKRRIAMGLINSCDVPTTNLRVKDNKLIGNQ
EKSNDVTNAIRKEMGDDVRATKMKDAPSSTDHVNGHSNGGNHYYASEDYSSEQRAAKRVR
KPTRRYIEELSETDDKQQNDKSVIPSKDQRLSEKSEVRSISVSSGKRVTVTRMVSLAGSE
IEVPYVSHVRRSRPRENIMALLGCHSSYLEDKASAAESNLNLSPSQLSSEVVNRDSVEKS
ASRPVQNEFATSDENNVEHILSEVDQEMEPEHIDSSGNSSDENNIGVPIMQGGALRRKHH
RAWTLSEIAKLVEGVSKYGAGKWSEIKKHLFSSHSYRTSVDLKDKWRNLLKTSFAQSPSN
SVGSLKKHGSMHIPTQILLRVRELAEKQSQ

www.000webhost.com

Other information
Ka divergence:-0.226849KaKs divergence:-0.359841
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1875Length 2 (bp):1893Length divergence:0.005
MFE 1 (kcal):-550.41MFE 2 (kcal):-551.11MFE divergence0.001