Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17470-AT1G72660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):developmentally regulated G-protein 1
Function (paralog2):P-loop containing nucleoside triphosphate hydrolases superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.4703560535428
Log2 mRNA fold difference:-4.5951394082264
Log2 TE fold difference:2.406615389518
Sequences
Protein sequence

MGIIERIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGASGGGEGFEVTKY
GHGRVALIGFPSVGKSTLLTMLTGTHSEAASYEFTTLTCIPGVIHYNDTKIQLLDLPGII
EGASEGKGRGRQVIAVAKSSDLVLMVLDASKSEGHRQILTKELEAVGLRLNKTPPQIYFK
KKKTGGISFNTTAPLTHIDEKLCYQILHEYKIHNAEVLFRENATVDDFIDVIEGNRKYIK
CVYVYNKIDVVGIDDVDRLSRQPNSIVISCNLKLNLDRLLARMWDEMGLVRVYSKPQGQQ
PDFDEPFVLSSDRGGCTVEDFCNHVHRTLVKDMKYALVWGTSTRHNPQNCGLSQHLEDED
VVQIVKKKERDEGGRGRFKSHSNAPARIADREKKAPLKQ

MGIVERIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGGGDGFEVTKY
GHGRVALIGFPSVGKSTLLTMLTGTHSEAASYEFTTLTCIPGVIHYNDTKIQLLDLPGII
EGASEGKGRGRQVIAVAKSSDLVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFK
KKKTGGISFNTTTPLTRIDEKLCYQILHEYKIHNAEVLFREDATVDDFIDVVEGNRKYIK
CVYVYNKIDVVGIDDVDRLARQPNSIVISCNLKLNLDRLLARMWDEMGLVRVYSKPQSQQ
PDFDEPFVLSADRGGCTVEDFCNQVHRTLVKDMKYALVWGTSARHYPQHCGLFHHLEDED
VVQIVKKKVREEGGRGRFKSHSNAPARIADREKKAPLKQ

Other information
Ka divergence:-0.101437KaKs divergence:-0.357216
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1200Length 2 (bp):1200Length divergence:0
MFE 1 (kcal):-352.56MFE 2 (kcal):-350.23MFE divergence-0.003