Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17480-AT1G72670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):IQ-domain 7
Function (paralog2):IQ-domain 8

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.52923710956333
Log2 mRNA fold difference:0.78090738097613
Log2 TE fold difference:-0.22597140402254
Sequences
Protein sequence

MGGSGNWIRSLISNRKPVNDQQEKLSDKSSKKKWKLWRISSESLASSSFKSRGSYAASSL
GSELPSFSADEAFTTAMAALIRAPPRDFLMVKREWASTRIQAAFRAFLARQAFRALKAVV
RIQAIFRGRQVRKQAAVTLRCMQALVRVQSRVRAHRRAPSDSLELKDPVKQTEKGWCGSP
RSIKEVKTKLQMKQEGAIKRERAMVYALTHQSRTCPSPSGRAITHHGLRKSSPGWNWYDD
VGTFSRKSSESSVLSEYETVTVRKNNLSSTRVLARPPLLLPPVSSGMSYDSLHDETSTSS
TSQSPVAFSSSVLDGGGYYRKPSYMSLTQSTQAKQRQSGLSCNGDARRSAGSDQCTDLYP
PGNVWAKSQRS

MGGSGNWIKSLITNKKNITDDQEKNIKKKWKLWRTSSEGLISSSKGFKSRGGSYGTPSLG
SDPPSFSADDSFTAAVAAVIRAPPKDFFLVKREWAATRIQAAFRAFLARQALRALKAVVR
IQAIFRGRQVRKQADVTLRCMQALVRVQARVRAHCNRGPSDGQELEKPSDQQKDDPAKQA
EKGWCDSPGSINEVRTKLQMRQEGAIKRERAMVYALTHQPRTCPSPAKASKQGSVKKNNG
SCKSSPGWNWLDRWVADRPWEGRLMEGPTNSSENARKSESSVSEHDTVQVRKNNLTTRVL
ARPPPMSSSATSSESSSTSQSPVPFSGSFLEEGGYYRKPSYMSLTQSIKAKQRRSGSSSS
CSKTPFEKKQSMSYNGDVNVRRSAGSDPLNNQWTDLYPPAQVTGRHMWAKSQRG

www.000webhost.com

Other information
Ka divergence:-0.169868KaKs divergence:-0.219741
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1116Length 2 (bp):1245Length divergence:0.055
MFE 1 (kcal):-355.5MFE 2 (kcal):-394MFE divergence0.051