Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17490-AT1G72690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.9713846943897
Log2 mRNA fold difference:-0.58809202553368
Log2 TE fold difference:-0.40369731550691
Sequences
Protein sequence

MAEPKQSSLSEVKTNVIGSRKEEKESMFHGKETHGRSEDIDEKTRVDDVKGPGVLGRMME
EMEAIVDAVTPNKSSDK

MADQNRSEEKTVKSPNVFERVKEEIEAMGHHEKSKSRHHDKETHGTSDDIDESTPIDYVK
GPGFFQRLKEEIEAIFNAVTPKRSSKK

Other information
Ka divergence:-0.166522KaKs divergence:0.939799
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):234Length 2 (bp):264Length divergence:0.06
MFE 1 (kcal):-56.3MFE 2 (kcal):-61.29MFE divergence0.042