Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17500-AT1G72700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein
Function (paralog2):ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.61618433226866
Log2 mRNA fold difference:0.28227308168104
Log2 TE fold difference:0.31710533535377
Sequences
Protein sequence

MARGRIRSKLRLSHIYTFGCLRPSADEGQDPHPIQGPGFSRTVYCNQPHMHKKKPLKYRS
NYVSTTRYNLITFFPKCLYEQFHRAANFYFLVAAILSVFPLSPFNKWSMIAPLVFVVGLS
MLKEALEDWSRFMQDVKINASKVYVHKSDGEFRRRKWKKISVGDIVKVEKDGFFPADLLL
LSSSYEDGICYVETMNLDGETNLKVKRSLEVTLSLDDYDSFKDFTGIIRCEDPNPSLYTF
VGNLEYERQIFPLDPSQILLRDSKLRNTPYVYGVVVFTGHDTKVMQNSTKSPSKRSRIEK
TMDYIIYTLLVLLILISCISSSGFAWETKFHMPKWWYLRPEEPENLTNPSNPVYAGFVHL
ITALLLYGYLIPISLYVSIEVVKVLQASFINKDLHMYDSESGVPAHARTSNLNEELGQVD
TILSDKTGTLTCNQMDFLKCSIAGTSYGVRSSEVEVAAAQQMAVDLDEHGEVSSRTSTPR
AQARDIEVESSITPRIPIKGFGFEDIRLMDGNWLREPHTDDILLFFRILAICHTAIPELN
EETGKYTYEAESPDEASFLTAASEFGFVFFKRTQSSVYVHERLSHSGQTIEREYKVLNLL
DFTSKRKRMSVVVRDEEGQILLLCKGADSIIFERLAKNGKVYLGPTTKHLNEYGEAGLRT
LALSYRKLDEEEYSAWNAEFHKAKTSIGSDRDELLERISDMIEKDLILVGATAVEDKLQK
GVPQCIDKLAQAGLKLWVLTGDKMETAINIGYSCSLLRQGMKQICITVVNSEGASQDAKA
VKDNILNQITKAVQMVKLEKDPHAAFALIIDGKTLTYALEDEMKYQFLALAVDCASVICC
RVSPKQKALVTRLVKEGTGKITLAIGDGANDVGMIQEADIGVGISGVEGMQAVMASDFSI
AQFRFLERLLVVHGHWCYKRIAQMICYFFYKNIAFGLTLFYFEAFTGFSGQSVYNDYYLL
LFNVVLTSLPVIALGVFEQDVSSEICLQFPALYQQGKKNLFFDWYRILGWMGNGVYSSLV
IFFLNIGIIYEQAFRVSGQTADMDAVGTTMFTCIIWAVNVQIALTVSHFTWIQHVLIWGS
IGLWYLFVALYGMMPPSLSGNIYRILVEILAPAPIYWIATFLVTVTTVLPYFAHISFQRF
LHPLDHHIIQEIKYYKRDVEDRRMWTRERTKAREKTKIGFTARVDAKIRHLRSKLNKKQS
NMSQFSTQDTMSPRSV

MARGRIRSKLRLSLLYTFGCLRPATLEGQDSQPIQGPGFSRTVFCNQPHMHKKKPLRYRS
NYVSTTRYNLITFFPKSLYEQFHRAANLYFLVAAILSVFPLSPFNKWSMIAPLVFVVGLS
MLKEALEDWRRFMQDVKINARKTCVHKSDGVFRQRKWKKVSVGDIVKVEKDEFFPADLLL
LSSSYEDGICYVETMNLDGETNLKVKRSLEVSLPLDDDESFKNFMATIRCEDPNPNLYTF
VGNLEFERQTFPLDPSQILLRDSKLRNTTYVYGVVVFTGFDTKVMQNSTKSPSKRSRIER
TMDYIIYTLLVLLILISCISSSGFAWETEFHMPKMWYLRPGEPIDFTNPINPIYAGVVHL
ITALLLYGYLIPISLYVSIEVVKVWQASFINQDLHMYDDESGVPANARTSNLNEELGQVH
TILSDKTGTLTCNQMDFLKCSIAGTSYGVRSSEVEVAAAKQMAVDLEEHGEISSTPQSQT
KVYGTWDSSRTQEIEVEGDNNYNTPRAPIKGFGFEDNRLMNGNWLRESQPNDILQFFRIL
AICHTAIPELNEETGKYTYEAESPDEASFLAAAREFGFEFFKRTQSSVFIRERFSGSGQI
IEREYKVLNLLEFTSKRKRMTVIVRDEEGQILLLCKGADSIIFERLAKNGKTYLGPTTRH
LTEYGEAGLRTLALAYRKLDEDEYAAWNSEFLKAKTSIGSDRDELLETGADMIEKELILI
GATAVEDKLQKGVPQCIDKLAQAGLKLWVLTGDKMETAINIGFACSLLRQGMRQICITSM
NSEGGSQDSKRVVKENILNQLTKAVQMVKLEKDPHAAFALIIDGKTLTYALEDDMKYQFL
ALAVDCASVICCRVSPKQKALVVRLVKEGTGKTTLAIGDGANDVGMIQEADIGVGISGVE
GMQAVMASDFSIAQFRFLERLLVVHGHWCYKRIAQMICYFFYKNIAFGLTLFYFEAFTGF
SGQSVYNDYYLLLFNVVLTSLPVIALGVFEQDVSSEICLQFPALYQQGTKNLFFDWSRIL
GWMCNGVYASLVIFFLNIGIIYSQAFRDNGQTADMDAVGTTMFTCIIWAANVQIALTMSH
FTWIQHVLIWGSIGMWYLFVAIYSMMPPSYSGNIYRILDEILAPAPIYWMATLLVTVAAV
LPYVAHIAFQRFLNPLDHHIIQEIKYYGRDIEDARLWTRERTKAREKTKIGFTARVDAKI
RHLRSKLNKKQSNLSHFSAQDAMSPRSL

www.000webhost.com

Other information
Ka divergence:0.0727093KaKs divergence:0.415818
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):3651Length 2 (bp):3687Length divergence:0.005
MFE 1 (kcal):-1098.99MFE 2 (kcal):-1103.21MFE divergence0.002