Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17520-AT1G72740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Homeodomain-like/winged-helix DNA-binding family protein
Function (paralog2):Homeodomain-like/winged-helix DNA-binding family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.67918980522652
Log2 mRNA fold difference:0.7978269524696
Log2 TE fold difference:-0.25912841227331
Sequences
Protein sequence

MGNQKLKWTAEEEEALLAGVRKHGPGKWKNILRDPELAEQLSSRSNIDLKDKWRNLSVAP
GIQGSKDKIRTPKIKAAAFHLAAAAAAAIVTPTHSGHSSPVATLPRSGSSDLSIDDSFNI
VVDPKNAPRYDGMIFEALSNLTDANGSDVSAIFNFIEQRQEVPPNFRRMLSSRLRRLAAQ
GKLEKVSHLKSTQNFYKMNDNSLVQRTPHVARPKESNTKSRQQTNSQGPSISQQIVEASI
TAAYKLVEVENKLDVSKGAAEEIERLMKLAEEADEMLVIAREMHEECSQGKIMYLN

MGNQKLKWTAEEEEALLAGIRKHGPGKWKNILRDPEFADQLIHRSNIDLKDKWRNLSVPP
GTQSLTNKARPAKVKEEGDTPAADANDAVTIPRPIPTIPPPPGRRTLPSELIPDENTKNA
PRYDGVIFEALSALADGNGSDVSSIYHFIEPRHEVPPNFRRILSTRLRRLAAQSKLEKVS
TFKSIQNFYKIPDPSGTKIGVPKPKETHTKLRQANNQTSADSQQMIEEAAITAACKVVEA
ENKIDVAKLAAEEFEKMTKIAEENRKLLVIATEMHELCSCGETMLLA

Other information
Ka divergence:0.348932KaKs divergence:0.0149303
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):891Length 2 (bp):864Length divergence:-0.015
MFE 1 (kcal):-244.63MFE 2 (kcal):-248.6MFE divergence0.008