Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17530-AT1G72750
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):translocase of inner mitochondrial membrane 23
Function (paralog2):translocase inner membrane subunit 23-2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.5455093906857
Log2 mRNA fold difference:1.5883577174108
Log2 TE fold difference:-0.015219996762346
Sequences
Protein sequence

MAINRSSDHESDENTRLYHPYQNYQVPIKSQYLYKLPTSPEFLFTEESLKQRRSWGENLT
FYTGTGYLAGSVAGASAGIFSGIKSFENGDTTKLKINRILNSSGQAGRTWGNRVGIVGLI
YAGIESGVVAVTDKDDVWTSVVAGLGTGAVFRAARGVRSAAVAGAFGGIAAGAVVAGKQV
FKRYAHI

MAANNRSDHGSDENTRLYNPYQNYEVPINKSQYLYKLPTSPEFLFTEEALRQRRSWGENL
TFYTGTAYLGGSVAGASVGVITGVKSFESGDTTKLKINRILNSSGQTGRTWGNRIGIIGL
VYAGIESGIVAATDRDDVWTSVVAGLGTGAVCRAARGVRSAAVAGALGGLAAGAVVAGKQ
IVKRYVPI

Other information
Ka divergence:-0.0920411KaKs divergence:0.311222
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):564Length 2 (bp):567Length divergence:0.003
MFE 1 (kcal):-189.1MFE 2 (kcal):-178.74MFE divergence-0.028