Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17590-AT1G72830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nuclear factor Y, subunit A8
Function (paralog2):nuclear factor Y, subunit A3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.1576648762566
Log2 mRNA fold difference:0.53250776071444
Log2 TE fold difference:0.39702056433162
Sequences
Protein sequence

MDKKVSFTSSVAHSTPPYLSTSISWGLPTKSNGVTESLSLKVVDARPERLINTKNISFQD
QDSSSTLSSAQSSNDVTSSGDDNPSRQISFLAHSDVCKGFEETQRKRFAIKSGSSTAGIA
DIHSSPSKANFSFHYADPHFGGLMPAAYLPQATIWNPQMTRVPLPFDLIENEPVFVNAKQ
FHAIMRRRQQRAKLEAQNKLIKARKPYLHESRHVHALKRPRGSGGRFLNTKKLQESTDPK
QDMPIQQQHATGNMSRFVLYQLQNSNDCDCSTTSRSDITSASDSVNLFGHSEFLISDCPS
QTNPTMYVHGQSNDMHGGRNTHHFSVHI

MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQ
ISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTG
FPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDP
VFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKVPYLHESRHVHALKRPRGSGGRFLNTKK
LLQESEQAAAREQEQDKLGQQVNRKTNMSRFEAHMLQNNKDRSSTTSGSDITSVSDGADI
FGHTEFQFSGFPTPINRAMLVHGQSNDMHGGGDMHHFSVHI

Other information
Ka divergence:-0.101295KaKs divergence:-0.095615
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):987Length 2 (bp):1026Length divergence:0.019
MFE 1 (kcal):-254.09MFE 2 (kcal):-270.91MFE divergence0.032