Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17710-AT1G73010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pyridoxal phosphate phosphatase-related protein
Function (paralog2):phosphate starvation-induced gene 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.1431054038428
Log2 mRNA fold difference:0.53306295057617
Log2 TE fold difference:1.4720370723522
Sequences
Protein sequence

MAKNNNIVIVFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMNRMMKELHDHG
KTIEEIKQVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTLFIETIIEHLGIGEFFSEI
NTNPGLVDEQGRLIVSPYHDFTKSSHGCSRCPPNMCKGLIIDRIQASLTKEGKTSKMIYL
GDGAGDYCPSLGLKAEDYMMPRKNFPVWDLISQNPMLVKATVRDWTDGEDMERILMEIIN
EIMSSEEGEENDKMLSSENCKISVGIVHEPIQVPLNLVK

MAYNSNSNNNNNNIVVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMM
KELHDQGKTIEEIKQVLRTIPIHPRVVPAIKSAHDLGCELRIVSDANMFFIETIVEHLGI
SELFSEINSNPGYVDERGTLKISPYHDFTKSPHSCSCGTCPPNMCKGLIIERIQQSLAKE
GKKKMIYLGDGAGDYCPSLKLNTEDYVMPRKNFPVWDLISQNPMLIKAAIREWTDGQSME
MILIGTIEEIRLEEEKEKMLTSAENNCKMQTISIGINNVHHEPILPRALRVSQSS

Other information
Ka divergence:0.0653352KaKs divergence:-0.502064
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):840Length 2 (bp):888Length divergence:0.028
MFE 1 (kcal):-242.4MFE 2 (kcal):-235.99MFE divergence-0.013