Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17730-AT1G73030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):vacuolar protein sorting 46.1
Function (paralog2):SNF7 family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.92395057086265
Log2 mRNA fold difference:1.2568770872712
Log2 TE fold difference:-0.3225617420205
Sequences
Protein sequence

MGNTDKLMNQIFELKFTSKSLQRQARKCEKEERSEKLKVKKAIEKGNMDGARIYAENAIR
KRSEQMNYLRLSSRLDAVVARLDTQAKMATITKSMTNIVKSLESSLTTGNLQKMSETMDS
FEKQFVNMEVQAEFMDNAMAGSTSLSTPEGEVNSLMQQVADDYGLEVSVGLPQPAGHAIP
TKTEEKVEEDDLTRRLAELKARG

MGNTDKLMNQIFDLKFTSKSLQRQSRKCEKEEKAEKLKVKKAIEKGNMDGARIYAENAIR
KRSEQMNYLRLASRLDAVVARLDTQAKMTTITKSMTNIVKSLESSLATGNLQKMSETMDS
FEKQFVNMEVQAEFMENAMAGSTSLSTPEGEVNSLMQQVADDYGLEVSVGLPQPAGHAIP
TKTEEKVDEDDLSRRLAELKARG

www.000webhost.com

Other information
Ka divergence:-0.830743KaKs divergence:-0.794393
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):612Length 2 (bp):612Length divergence:0
MFE 1 (kcal):-179.9MFE 2 (kcal):-190.15MFE divergence0.028