Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17750-AT1G73080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PEP1 receptor 2
Function (paralog2):PEP1 receptor 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.1446442432288
Log2 mRNA fold difference:3.4315791362982
Log2 TE fold difference:-1.2720877634279
Sequences
Protein sequence

MRNLGLLEITLLCSLFVYFRIDSVSSLNSDGLALLSLLKHFDKVPLEVASTWKENTSETT
PCNNNWFGVICDLSGNVVETLNLSASGLSGQLGSEIGELKSLVTLDLSLNSFSGLLPSTL
GNCTSLEYLDLSNNDFSGEVPDIFGSLQNLTFLYLDRNNLSGLIPASVGGLIELVDLRMS
YNNLSGTIPELLGNCSKLEYLALNNNKLNGSLPASLYLLENLGELFVSNNSLGGRLHFGS
SNCKKLVSLDLSFNDFQGGVPPEIGNCSSLHSLVMVKCNLTGTIPSSMGMLRKVSVIDLS
DNRLSGNIPQELGNCSSLETLKLNDNQLQGEIPPALSKLKKLQSLELFFNKLSGEIPIGI
WKIQSLTQMLVYNNTLTGELPVEVTQLKHLKKLTLFNNGFYGDIPMSLGLNRSLEEVDLL
GNRFTGEIPPHLCHGQKLRLFILGSNQLHGKIPASIRQCKTLERVRLEDNKLSGVLPEFP
ESLSLSYVNLGSNSFEGSIPRSLGSCKNLLTIDLSQNKLTGLIPPELGNLQSLGLLNLSH
NYLEGPLPSQLSGCARLLYFDVGSNSLNGSIPSSFRSWKSLSTLVLSDNNFLGAIPQFLA
ELDRLSDLRIARNAFGGKIPSSVGLLKSLRYGLDLSANVFTGEIPTTLGALINLERLNIS
NNKLTGPLSVLQSLKSLNQVDVSYNQFTGPIPVNLLSNSSKFSGNPDLCIQASYSVSAII
RKEFKSCKGQVKLSTWKIALIAAGSSLSVLALLFALFLVLCRCKRGTKTEDANILAEEGL
SLLLNKVLAATDNLDDKYIIGRGAHGVVYRASLGSGEEYAVKKLIFAEHIRANQNMKREI
ETIGLVRHRNLIRLERFWMRKEDGLMLYQYMPNGSLHDVLHRGNQGEAVLDWSARFNIAL
GISHGLAYLHHDCHPPIIHRDIKPENILMDSDMEPHIGDFGLARILDDSTVSTATVTGTT
GYIAPENAYKTVRSKESDVYSYGVVLLELVTGKRALDRSFPEDINIVSWVRSVLSSYEDE
DDTAGPIVDPKLVDELLDTKLREQAIQVTDLALRCTDKRPENRPSMRDVVKDLTDLESFV
RSTSGSVH

MKNLGGLFKILLLFFCLFLSTHIISVSCLNSDGLTLLSLLKHLDRVPPQVTSTWKINASE
ATPCNWFGITCDDSKNVASLNFTRSRVSGQLGPEIGELKSLQILDLSTNNFSGTIPSTLG
NCTKLATLDLSENGFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLFRIPKLQVLYLDY
NNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLPESLN
LLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCSSLDALVIVS
GNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALG
KLRKLESLELFENRFSGEIPIEIWKSQSLTQLLVYQNNLTGELPVEMTEMKKLKIATLFN
NSFYGAIPPGLGVNSSLEEVDFIGNKLTGEIPPNLCHGRKLRILNLGSNLLHGTIPASIG
HCKTIRRFILRENNLSGLLPEFSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRN
RFTGQIPPQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVGFNSLNGSVPSNFSN
WKGLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGLIEDLIYDLDLSG
NGLTGEIPAKLGDLIKLTRLNISNNNLTGSLSVLKGLTSLLHVDVSNNQFTGPIPDNLEG
QLLSEPSSFSGNPNLCIPHSFSASNNSRSALKYCKDQSKSRKSGLSTWQIVLIAVLSSLL
VLVVVLALVFICLRRRKGRPEKDAYVFTQEEGPSLLLNKVLAATDNLNEKYTIGRGAHGI
VYRASLGSGKVYAVKRLVFASHIRANQSMMREIDTIGKVRHRNLIKLEGFWLRKDDGLML
YRYMPKGSLYDVLHGVSPKENVLDWSARYNVALGVAHGLAYLHYDCHPPIVHRDIKPENI
LMDSDLEPHIGDFGLARLLDDSTVSTATVTGTTGYIAPENAFKTVRGRESDVYSYGVVLL
ELVTRKRAVDKSFPESTDIVSWVRSALSSSNNNVEDMVTTIVDPILVDELLDSSLREQVM
QVTELALSCTQQDPAMRPTMRDAVKLLEDVKHLARSCSSDSVR

www.000webhost.com

Other information
Ka divergence:-0.108669KaKs divergence:-0.0761612
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3267Length 2 (bp):3372Length divergence:0.016
MFE 1 (kcal):-1013.92MFE 2 (kcal):-1051.69MFE divergence0.018