Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17780-AT1G73130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.9895900493082
Log2 mRNA fold difference:-1.9670083886438
Log2 TE fold difference:0.073891945473054
Sequences
Protein sequence

MNRNSKGRAWYDKIYRKLASQGNVSSGLDSVKDEPEKLREEQMEGDGFKEKLSDSVLIDE
KLEEYSDCDRTATTSRSHTDPVSSQSTHQTPESFRTPITCDDDTFVSVSGISRDVSNLIP
FATETPASPVQEKMANTRSFSNNSVKGNQDEFFIEDFDVGPMDTIDLYDMTFREDPSDFD
DNLLYAMRDRTKQLRSFKRKIMDAIKSKRRREKEYEQLAIWFGDADMGCDLVNDKEQSTT
SIDSKSSQTNVPVVSEDSEWEIL

MGPESKGRAWFSKIYNKLENLLVEVDSFTSQSTLCLKSSEPPRFEYVRGESKEVAEDHSS
NVQGRHDRVASPRSESPSDPPSHQNFDIPGHVLVEKRVQGDILKENVVQRDSFEDNSSAS
SSSDGEIESTSPLHEEYCDAYMTSTTTLSDEEQLVSDEESQIFPDGERLSTSPLLEEYHD
ANLTSAASVGDEEPIVTDKESHITKSLSNSPSCNSPSDSPPCQNFDILGHVRVEERVQGD
ILVENIAHGENSSASSLDGEETLSTSPLLEELCDANLTSTSTLGGEEPIVTDDESQITNT
LTPQKFSAENSSVFPGEESVQEVRVESSLSDEEILSKSPLLEEHCDANLTSTSTLGGEGP
IVTDDESLITNTLTPQKFSEEEILSKSPLLEEHCDANLTSDTTLGDEKPIITDDESWISN
SLTSQKSSAGNSWVFSGEDSVEEVKVKSCRDVVSTESQSTQSSMESFGTVVKCNDGPVLA
ALGCFRDNDSSLNPLVTKVPDENMRSSNADNPDDVINNCKSDVTPLDTKDIAFQKEPSYV
NDTVRVRIMAELCGMESREDPLYVEDSELYAIHLRTKKLRSFKRKVLDVLTSKRRREKEY
EQLPIWYGDAGMGSDLATKEESQQVEATDSKSSLLLESEDSQWELL

Other information
Ka divergence:0.151459KaKs divergence:0.862809
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):792Length 2 (bp):1941Length divergence:0.42
MFE 1 (kcal):-201.36MFE 2 (kcal):-564.9MFE divergence0.474