Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17790-AT1G73150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNA-binding bromodomain-containing protein
Function (paralog2):global transcription factor group E3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.57536591417469
Log2 mRNA fold difference:-0.31883723503647
Log2 TE fold difference:-0.27934483849912
Sequences
Protein sequence

MSSEHISGGGASKTKKHKWSSSQNRPKPMGVSRQERSVPLVSPSNSFASEDDHHMLKISL
SSISKLEVRNLKRKLKSELDEVRSLIKRFDPEANPGGSMAKSGVVGRSKKVKTGNGGGKK
SGHGADKGTVQIFKNCNSLLTKLMKHKSAWVFNVPVDAKGLGLHDYHNIVKEPMDLGTVK
TKLGKSLYKSPLDFAEDVRLTFNNAILYNPIGHDVYRFAELLLNMFEDKWVSIEMQYDNL
HRKFKPTRDIEFPAPAPSIAPIVEPLPAIVPSPSPSSPPPPPPPPVAAPVLENRTWEREE
SMTIPVEPEAVITAPEKAEEEEAPVNNRDLTLEEKRRLSEELQDLPYDKLETVVQIIKKS
NPELSQKDDEIELDIDSLDINTLWELYRFVTGYKESLSKKNEAHGFGSERDAESVHNSIQ
EPTTLVSGTTTSRVTESGKAIRTSSPARQENNASGSSSSNSSSSDSGSCSSDTDSDSSSG
RGSDNGN

MASGPIAGGGVSKTKHKWSDSGNKSQKRSKPTVANSNSLGLEDNHQMMKISLSSISKLEV
RNLKRKLQAELEEVRSLIKRLEPQGNNFAPVPNKKLKTANGGKKGGVHGAAADKGTVQIL
KSCNNLLTKLMKHKSGWIFNTPVDVVTLGLHDYHNIIKEPMDLGTVKTRLSKSLYKSPLE
FAEDVRLTFNNAMLYNPVGHDVYHMAEILLNLFEEKWVPLETQYELLIRKQQPVRDIDFH
APVSTNTHNVEALPLPAPTPSLSPPPPPKVVENRTLERAESMTNPVKPAVLPVVPEKLVE
EASANRDLTFDEKRQLSEDLQDLPYDKLEAVVQIIKKRTPELSQQDDEIELDIDSLDLET
LWELFRFVTEYKESLSKKKEEQGLDSERDAESFHNSVHESNTLVTGLESSKVTELGHVAS
TVRQEVNVGGSSSSNSSSSGSGSGSSGSDSDSSGHESDTGN

www.000webhost.com

Other information
Ka divergence:-0.0258727KaKs divergence:-0.422481
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1464Length 2 (bp):1386Length divergence:-0.027
MFE 1 (kcal):-428.47MFE 2 (kcal):-401.85MFE divergence-0.032