Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17810-AT1G73190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):beta-tonoplast intrinsic protein
Function (paralog2):Aquaporin-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.8922994790487
Log2 mRNA fold difference:2.8345672888018
Log2 TE fold difference:-0.18323794856376
Sequences
Protein sequence

MATSARRAYGFGRADEATHPDSIRATLAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGT
NTPGGLVLVALAHALALFAAVSAAINVSGGHVNPAVTFAALIGGRISVIRAIYYWVAQLI
GAILACLLLRLATNGLRPVGFHVASGVSELHGLLMEIILTFALVYVVYSTAIDPKRGSIG
IIAPLAIGLIVGANILVGGPFDGASMNPARAFGPALVGWRWSNHWIYWVGPFIGGALAAL
IYEYMIIPSVNEPPHHSTHQPLAPEDY

MATSARRAYGFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWEHAAHAGT
NTPGGLILVALAHAFALFAAVSAAINVSGGHVNPAVTFGALVGGRVTAIRAIYYWIAQLL
GAILACLLLRLTTNGMRPVGFRLASGVGAVNGLVLEIILTFGLVYVVYSTLIDPKRGSLG
IIAPLAIGLIVGANILVGGPFSGASMNPARAFGPALVGWRWHDHWIYWVGPFIGSALAAL
IYEYMVIPTEPPTHHAHGVHQPLAPEDY

Other information
Ka divergence:0.144683KaKs divergence:0.999945
GC content 1 (%):51GC content 2 (%):49GC content divergence:-0.02
Length 1 (bp):804Length 2 (bp):807Length divergence:0.002
MFE 1 (kcal):-283.9MFE 2 (kcal):-260.5MFE divergence-0.043