Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17820-AT1G73200
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Putative integral membrane protein conserved region (DUF2404)
Function (paralog2):Putative integral membrane protein conserved region (DUF2404)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.2512627496861
Log2 mRNA fold difference:1.0342483691089
Log2 TE fold difference:0.17246258447711
Sequences
Protein sequence

MFSFVGFVVFLSGFFLGILAVLSAEAAGFMYLLKRLNRKRDRIESKPVSDPSIKDFNPRE
SIDFCINKQGVVWILELDEGLKNWMKEKLPKEQKRKRGLLEIHPLRKFARIKDHKLILSD
ADSTQSETTVSLIGCSIEAVSGSDLPTRKWAKRFPIKVESKISPALYKGNQVFYIYLETS
WEKESWCKALRLASCENQERFIWYSTKLKEDFRNYVTSLNVAYPSFMKPSLGFSFETLDK
GNRTDGSSSKVRLFLKKFSRKRSNREDRKTYSHHGSSSGKCFPGKNNMTDDTDVPIFSRS
VSHSSHISGVSHLSGVSDGDSEEKVDMDEGTLALNLLISRLFFDLKRKTGVKNSVQARIQ
RLLSNMRTPSYIGELICSDVDTGNLPPHIHATRVLPMEMSGVWAFELDIEYSGDVVIDVE
TRVDIREVDLQQGITDTRLQPRSSGVVPSNFAEGVEDFEKQLVFPVETVNAGEVKNGGAN
KADESKSSRGTKAAPNGVSRWKSILKTIAEQVSQVPISLSIRVSSLRGTLRVHMKPPPSD
QLWFGFTSMPDIEFDLASSVGEHKITNSHVAMFLINRFKTAIREAVVLPNCESLTIPWMI
AEKDDWVQRKAAPFMWLNQENDHNTSHATEARSKSDKPPTSFSCLQAEQMQRTANATQKI
ISEIGTLASSSCAQSEQVQKAATAFQKQNTEAEAIMSTPLSNSTTVTIENDKSLEELKTP
LLVPSSSNKQETNSRGSSREVSAVQSPSRSVASSEEDDSRGKKQGRRARMLDLGKKMGEK
LEEKRRHMEEKSRQIVEKMRGPS

MVSFTGFAFVFGILLGILAIVTAEVVGFLYLLKRLNRKRDRQESNSSSDPNFKSFDPRQS
IDFSLNKQGVIWILELDENVKDWMKEKLPKEQKKKRVDLLEVHPVRRFARIKDHKLILSD
SLDGPQTPITLKGCFVDAVSGSGPTRKWAKRFPIQVESKTSVLYKGNRVFYIFLETSWEK
ESWCKALRLAACENQERFIWSTKLKEDFRNYLASLNAAYPSFMKPSAGFSFESLDKGLKA
DGPSSKVRLIWKKFSKKCSTKVNFPPSIRDDKKTSSRSYQDSQSTGSSGKSTSARRMQDN
IPEETDVQVISRSWSHSSHASDVDSEDKSFDEGTLALNVVLSRLFFDVKQNTVLKNLVRE
RIQRIMSNMRIPSYIGELICCDVDIGNLPPYIHGTRILPMEMNGVWAFEIDIEYTGGAGL
EVETRVDAREEDLQKGIAEGKLQPNSAGDVPPDLLEGLADFEKQLNVPGGTVDAQDVKSG
GTDKADESKGPKGTKTGSSNGSKWKSMLKNIVEQVSQVPITLSIGVSSLRGTLCVHMKPP
PSDQLWFGFTSMPDIEFNLVSSVGEHKITNSHVAMFLVNRFKTAIRDVMVLPNCESVTIP
WMTAEKDDWVERNVAPFMWLNQDSTSDRENLEAAEAKSKADKPPTSEQMQKTVNIPQKPR
IEEESVSADTAPSANSIALLVESDKSLEELKTPLLESSEKHDTIARGGSAGDIIPGIGQS
PSMSTVSGEEDDSNSKGKKMGAAKARMFDFRKKVGEKFEEKKRHVEEKSRQIVEKMRGP

Other information
Ka divergence:0.0619285KaKs divergence:0.105411
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2412Length 2 (bp):2340Length divergence:-0.015
MFE 1 (kcal):-710.77MFE 2 (kcal):-707.7MFE divergence-0.002