Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17880-AT1G73230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic transcription factor 3
Function (paralog2):Nascent polypeptide-associated complex NAC

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.46310546063856
Log2 mRNA fold difference:0.1951630499388
Log2 TE fold difference:-0.62156931241965
Sequences
Protein sequence

MNREKLMKMANTVRTGGKGTVRRKKKAVHKTNTTDDKRLQSTLKRIGVNSIPAIEEVNIF
KDDVVIQFINPKVQASIAANTWVVSGSPQTKKLQDILPQIISQLGPDNMDNLKKLAEQFQ
KQASGEGNAASATIQEEDDDDVPELVGETFETAAEEKAPAAAASS

MNREKLMKMANTVRTGGKGTVRRKKKAVHKTTTTDDKRLQSTLKRVGVNSIPAIEEVNIF
KDDVVIQFINPKVQASIAANTWVVSGTPQTKKLQDILPQIISQLGPDNLDNLKKLAEQFQ
KQAPGAGDVPATIQEEDDDDDVPDLVVGETFETPATEEAPKAAAS

www.000webhost.com

Other information
Ka divergence:-0.0937162KaKs divergence:-0.999897
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):498Length 2 (bp):498Length divergence:0
MFE 1 (kcal):-146.6MFE 2 (kcal):-134.78MFE divergence-0.042