Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17890-AT1G73250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NAD(P)-binding Rossmann-fold superfamily protein
Function (paralog2):GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase 1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.08872937762
Log2 mRNA fold difference:-1.5889239759728
Log2 TE fold difference:0.526743247139
Sequences
Protein sequence

MADNTGSEMKSGSFMLEKSAKIFVAGHRGLVGSAIVRKLQDQGFTNLVLRTHSELDLTSQ
SDVESFFATEKPVYVILAAAKVGGIHANNTYPADFIGVNLQIQTNVIHSAYTHGVKKLLF
LGSSCIYPKFAPQPIPESALLTGPLEPTNEWYAIAKIAGIKMCQAYRLQHQWDAISGMPT
NLYGQNDNFHPENSHVLPALMRRFHEAKANNADEVVVWGSGSPLREFLHVDDLADACVFL
MDQYSGFEHVNVGSGVEVTIKELAELVKEVVGFKGKLVWDTTKPDGTPRKLMDSSKLASL
GWTPKISLKDGLSQTYEWYLENVVQKKQ

MAETIGSEVSSMSDKSAKIFVAGHRGLVGSAIVRKLQEQGFTNLVLKTHAELDLTRQADV
ESFFSQEKPVYVILAAAKVGGIHANNTYPADFIGVNLQIQTNVIHSAYEHGVKKLLFLGS
SCIYPKFAPQPIPESALLTASLEPTNEWYAIAKIAGIKTCQAYRIQHGWDAISGMPTNLY
GPNDNFHPENSHVLPALMRRFHEAKVNGAEEVVVWGTGSPLREFLHVDDLADACVFLLDR
YSGLEHVNIGSGQEVTIRELAELVKEVVGFEGKLGWDCTKPDGTPRKLMDSSKLASLGWT
PKVSLRDGLSQTYDWYLKNVCNR

www.000webhost.com

Other information
Ka divergence:0.301183KaKs divergence:-0.0115894
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):987Length 2 (bp):972Length divergence:-0.008
MFE 1 (kcal):-312.6MFE 2 (kcal):-322.34MFE divergence0.015