Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17920-AT1G73360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):homeodomain GLABROUS 12
Function (paralog2):homeodomain GLABROUS 11

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.75905722570442
Log2 mRNA fold difference:0.0091864205657018
Log2 TE fold difference:0.70586772150469
Sequences
Protein sequence

MEFLGDSQNHDSSETEKKNKKKKRFHRHTPHQIQRLESTFNECQHPDEKQRNQLSRELGL
APRQIKFWFQNRRTQKKAQHERADNCALKEENDKIRCENIAIREAIKHAICPSCGDSPVN
EDSYFDEQKLRIENAQLRDELERVSSIAAKFLGRPISHLPPLLNPMHVSPLELFHTGPSL
DFDLLPGSCSSMSVPSLPSQPNLVLSEMDKSLMTNIAVTAMEELLRLLQTNEPLWIKTDG
CRDVLNLENYENMFTRSSTSGGKKNNLGMEASRSSGVVFTNAITLVDMLMNSVKLTELFP
SIVASSKTLAVISSGLRGNHGDALHLMIEELQVLSPLVTTREFCVLRYCQQIEHGTWAIV
NVSYEFPQFISQSRSYRFPSGCLIQDMSNGYSKVTWVEHGEFEEQEPIHEMFKDIVHKGL
AFGAERWIATLQRMCERFTNLLEPATSSLDLGGVIPSPEGKRSIMRLAHRMVSNFCLSVG
TSNNTRSTVVSGLDEFGIRVTSHKSRHEPNGMVLCAATSFWLPISPQNVFNFLKDERTRP
QWDVLSNGNSVQEVAHITNGSNPGNCISVLRGFNASSSQNNMLILQESCIDSSSAALVIY
TPVDLPALNIAMSGQDTSYIPILPSGFAISPDGSSKGGGSLITVGFQIMVSGLQPAKLNM
ESMETVNNLINTTVHQIKTTLNCPSTA

MSFVVGVGGSGSGSGGDGGGSHHHDGSETDRKKKRYHRHTAQQIQRLESSFKECPHPDEK
QRNQLSRELGLAPRQIKFWFQNRRTQLKAQHERADNSALKAENDKIRCENIAIREALKHA
ICPNCGGPPVSEDPYFDEQKLRIENAHLREELERMSTIASKYMGRPISQLSTLHPMHISP
LDLSMTSLTGCGPFGHGPSLDFDLLPGSSMAVGPNNNLQSQPNLAISDMDKPIMTGIALT
AMEELLRLLQTNEPLWTRTDGCRDILNLGSYENVFPRSSNRGKNQNFRVEASRSSGIVFM
NAMALVDMFMDCVKWTELFPSIIAASKTLAVISSGMGGTHEGALHLLYEEMEVLSPLVAT
REFCELRYCQQTEQGSWIVVNVSYDLPQFVSHSQSYRFPSGCLIQDMPNGYSKVTWVEHI
ETEEKELVHELYREIIHRGIAFGADRWVTTLQRMCERFASLSVPASSSRDLGGVILSPEG
KRSMMRLAQRMISNYCLSVSRSNNTRSTVVSELNEVGIRVTAHKSPEPNGTVLCAATTFW
LPNSPQNVFNFLKDERTRPQWDVLSNGNAVQEVAHISNGSHPGNCISVLRGSNATHSNNM
LILQESSTDSSGAFVVYSPVDLAALNIAMSGEDPSYIPLLSSGFTISPDGNGSNSEQGGA
STSSGRASASGSLITVGFQIMVSNLPTAKLNMESVETVNNLIGTTVHQIKTALSGPTAST
TA

Other information
Ka divergence:-0.0934322KaKs divergence:-0.178531
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):2064Length 2 (bp):2169Length divergence:0.025
MFE 1 (kcal):-585.53MFE 2 (kcal):-677.1MFE divergence0.073