Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17940-AT1G73390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Endosomal targeting BRO1-like domain-containing protein
Function (paralog2):Endosomal targeting BRO1-like domain-containing protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.8378523158833
Log2 mRNA fold difference:1.4069905409176
Log2 TE fold difference:0.17147256125716
Sequences
Protein sequence

MGCFASTPKDSGGNRRKPTSIGEVSVYVPGLRIPRAVDFLQSLGDQLPKTLVERLTALRT
RIVVMANQEGPTITRTRRKTQHGGSTLLDLHQALLDYLPVVLGLTKDGSHLQFKVQFNWV
NQEDEEEETEMSNVWYEVLSVLHLMAMLQMSQANLLLLPRGSSDGHNHPKVSEENRRTSI
DIFLKAAGYLDCAVKHVLPQFSAEQRRSLPVDLAEGTLRALCLQALGQGVDIQLGMAIDS
SKATLAVKRRLSCEMVKYWQQAQDNLMNLPLANGWGEKHGLFVKWKYVEAKAAAYYYHGL
ILDEGNTEKSHGMAVAALQAADECFKESKKASEAFNASAPTSRTPPLFGTMKYLTEKIPK
DTSSKVRINRDLYSYEKIMETAPTLPDFALALKPDEYQLPLAEAS

MGCFASRPNDTGGNRRKPTSIGDVSVYVPGLRIPKPVEFSQSLGDQLPKTLVERLTALRT
RIVVMANQEGPTITRTRRKTQHGGSTLADLHHALEDYIPVLLGLTKDGSHLQFKVQFNWV
NQEDEEEETAMSNVWYEILSVLHLMAMLQMSQANLLLLPRGSSDGYHPKISEENRRASID
IFLKAAGYLDCAVKHVLPHFSTEQRRSLPIDLAEGALRALCLQALGQGVDIQLGMAIDSA
KATLAVKRRLSCEMVKYWQQAQDNLMNLPLANGWGEKHMLFVKWKYVEAKAAAYYYHGLI
LDEGNTEKSHGMAVAALQAADECLKESKKASEAFNTSSPTSRTPSLFGTMKYLSEKIPKE
TSSKVRINRDLYSYEKIMETAPTLPDFALALKPDEYQLPSVDASWSEASLRTKNTSNHI

Other information
Ka divergence:0.0495026KaKs divergence:-0.255693
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1218Length 2 (bp):1260Length divergence:0.017
MFE 1 (kcal):-353.43MFE 2 (kcal):-362.99MFE divergence0.013