Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17950-AT1G73410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 52
Function (paralog2):myb domain protein 54

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.4604444877198
Log2 mRNA fold difference:-0.50110339076374
Log2 TE fold difference:-0.15195165179714
Sequences
Protein sequence

MMCSRGHWRPAEDEKLRELVEQFGPHNWNAIAQKLSGRSGKSCRLRWFNQLDPRINRNPF
TEEEEERLLASHRIHGNRWSVIARFFPGRTDNAVKNHWHVIMARRGRERSKLRPRGLGHD
GTVAATGMIGNYKDCDKERRLATTTAINFPYQFSHINHFQVLKEFLTGKIGFRNSTTPIQ
EGAIDQTKRPMEFYNFLQVNTDSKIHELIDNSRKDEEEDVDQNNRIPNENCVPFFDFLSV
GNSASQGLC

MIMCSRGHWRPAEDEKLKDLVEQYGPHNWNAIALKLPGRSGKSCRLRWFNQLDPRINRNP
FTEEEEERLLAAHRIHGNRWSIIARLFPGRTDNAVKNHWHVIMARRTRQTSKPRLLPSTT
SSSSLMASEQIMMSSGGYNHNYSSDDRKKIFPADFINFPYKFSHINHLHFLKEFFTGKIA
LNHKANQSKKPMEFYNFLQVNTDSNKSEIIDQDSGQSKRSDSDTKHESHVPFFDFLSVGN
SAS

www.000webhost.com

Other information
Ka divergence:0.0933333KaKs divergence:-0.549616
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):750Length 2 (bp):732Length divergence:-0.012
MFE 1 (kcal):-215.93MFE 2 (kcal):-185.6MFE divergence-0.076