Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18040-AT1G73690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cyclin-dependent kinase D1;3
Function (paralog2):cyclin-dependent kinase D1;1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.2411379116366
Log2 mRNA fold difference:-0.98945553166466
Log2 TE fold difference:-0.2778167177246
Sequences
Protein sequence

MPEQPKKVADRYLKQEVLGQGTYGVVFKATDTKTEQTVAIKKIRLGKQREGVNITALREI
KMLKELKHPHIILLIDAFPHKENLHLVFEFMETDLEAVIRDSNIFLSPADIKSYLLMTFK
GLAYCHDKWVLHRDMKPNNLLIGVDGQLKLADFGLARIFGSPNRKFTHQVFARWYRAPEL
LFGAKQYGAAVDVWAVACIFAELLLRRPFLQGNSDIDQLSKIFAAFGTPKADQWPDLTKL
PDYVEYQFVPAPSLRSLFPAVSDDALDLLSKMFTYDPKARISIKQALEHRYFTSAPAPTD
PAKLPKPVPKQDGKSSYGKHEAITVQSPPRKLRRVMPERGRVDSLKSHVDKDQQAPMSLD
FTILAERPPNRPTITSADRSHLKRKLDLEFQ

MEQPKKVADRYLKREVLGQGTYGVVFKATDTKNGETVAIKKIRLGKEKEGVNVTALREIK
LLKELKHPHIIELIDAFPHKENLHIVFEFMETDLEAVIRDRNLYLSPGDVKSYLQMILKG
LEYCHGKWVLHRDMKPNNLLIGPNGQLKLADFGLARIFGSPGRKFTHQVFARWYRAPELL
FGAKQYDGAVDVWAAGCIFAELLLRRPFLQGNSDIDQLSKIFAAFGTPKADQWPDMICLP
DYVEYQFVPAPSLRSLLPTVSEDALDLLSKMFTYDPKSRISIQQALKHRYFTSAPSPTDP
LKLPRPVSKQDAKSSDSKLEAIKVLSPAHKFRRVMPDRGKSGNGFKDQSVDVMRQASHDG
QAPMSLDFTILAERPPNRPTITSADRSHLKRKLDLEFL

Other information
Ka divergence:0.180275KaKs divergence:-0.178893
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1176Length 2 (bp):1197Length divergence:0.009
MFE 1 (kcal):-332.8MFE 2 (kcal):-351.95MFE divergence0.028