Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18150-AT1G73670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):MAP kinase 15

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.79644554767074
Log2 mRNA fold difference:-0.89944320680905
Log2 TE fold difference:-0.029565318519402
Sequences
Protein sequence

MGGGGNLVDGVRRWLFQRPSSSSSSSSSNNNNNNHEQPIFNSSSFSSSSNPNHSANSGEL
IIEEDLDFSGLTLINVPKRNHLPMDPHKKGETEFFTEYGEANRYQIQEVVGKGSYGVVAS
AVDSHTGERVAIKKINDVFEHVSDATRILREIKLLRLLRHPDVVEIKHIMLPPSRREFRD
IYVVFELMESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYVHAANVFHRDLKPKNILANA
DCKLKICDFGLARVSFNDAPTAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSVGCIF
AEMLLGKPLFPGKNVVHQLDLMTDFLGTPPPESISRIRNEKARRYLSSMRKKQPVPFSHK
FPKADPLALRLLERLLAFDPKDRASAEDALADPYFSGLSNSEREPTTQPISKLEFDFERK
KLVKDDVRELIYREILEYHPQMLEEYLRGGDQLSFMYPSGVDRFKRQFAHLEENQGKPGA
AGGGRSTALHRHHASLPRERVPAPNGETAEESSDVERRAAAAVASTLESEEADNGGGYSA
RNLMKSASISGSKCIGVQSKTDKEDTIAEEEDNETVAELTDKVASLHNS

MGGGGNLVDGVRRWLFFQRRPSSSSSSNNHDQIQNPPTVSNPNDDEDLKKLTDPSKLRQI
KVQQRNHLPMEKKGIPNAEFFTEYGEANRYQIQEVVGKGSYGVVGSAIDTHTGERVAIKK
INDVFDHISDATRILREIKLLRLLLHPDVVEIKHIMLPPSRREFRDVYVVFELMESDLHQ
VIKANDDLTPEHHQFFLYQLLRGLKYVHAANVFHRDLKPKNILANADCKLKICDFGLARV
SFNDAPTAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSVGCIFAEMLLGKPLFPGKN
VVHQLDIMTDFLGTPPPEAISKIRNDKARRYLGNMRKKQPVPFSKKFPKADPSALRLLER
LIAFDPKDRPSAEEALADPYFNGLSSKVREPSTQPISKLEFEFERKKLTKDDIRELIYRE
ILEYHPQMLEEYLRGGNQLSFMYPSGVDRFRRQFAHLEENQGPGGRSNALQRQHASLPRE
RVPASKNETVEERSNDIERRTTAAVASTLDSPKASQQAEGTENGGGGGYSARNLMKSSSI
SGSKCIGVQSKTNIEDSIVEEQDETVAVKVASLHNS

www.000webhost.com

Other information
Ka divergence:0.164909KaKs divergence:-0.410813
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):1770Length 2 (bp):1731Length divergence:-0.011
MFE 1 (kcal):-537.03MFE 2 (kcal):-493.6MFE divergence-0.042