Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18160-AT1G73660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):protein tyrosine kinase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.56801853981314
Log2 mRNA fold difference:0.92854541752607
Log2 TE fold difference:-0.35473471880117
Sequences
Protein sequence

MKMNMKKFLKKLRITPNQRDDGEGSVSNRSNKSSDAEPSPSDSLRSQDNSEFKPFLGLSN
WLSSVTHRKSPSSSNATNSKEDDTTMEHGGPVGSESGMQGLGSSSNSKDPEVEEEYQIQL
ALELSAREDPEAAQIEAMKQFSLGSRPSAPENTPAELMAYRYWNYNCLGYDDKIVDGFYD
LCGVMNESSLKRIPPLVDLQGTLVSDGVTWDAVLVNSSKDSNLLRLEQMALDIAAKSKSA
SSSGFVNSELVRQLAVLVADYMGGPVLDPDSTLRAWWSLSYSLKATLRSMVLPLGSLTIG
LARHRALLFKVLCDSVGVPCRIVKGQQYTGSDDVAMNSIKTDDGREYIVDLMGDPGTLIP
ADAAGLQMDFDDSVYSASPRDVDSSHVASSSSGVESSIEEHTESWSAEHRSRTKGSREEN
QSAGGGDLMIPNIREAVGSQKAPVQHLSSKPTHSFTHARSPSWTEGVSSPAGRRMKVKDV
SQYMIDAAKENPQLAQKLHDVLLESGVVAPRNLFSEVYSESMEATGEIKSVAESNDEKGK
DFGTIQQGRNQSNLGPVRFLPPLPRPQSKAITHDLREHSGSGLGHLSEHCNIDGHSDSSH
SETSTDYPRNVPVAVAAAAVVASSMVVAAAKSANSDSSTLELSAAAAAAVMATAAAVSRQ
FELDSLSNGDAGSGGLHGVDSGGERISDRSIGNESSKSDAAIDDVAECEILWEEITVAER
IGLGSYGEVYRGDWHGTAVAVKKFIDQDITGEALEEFRSEVRMMRRLRHPNIVLFMGAVT
RPPNLSIVTEFLPRGSLYRLIHRPNNQLDERKRLRMALDAARGMNYLHSCNPVIVHRDLK
SPNLLVDKNWVVKVCDFGLSRMKVSTYLSSKSTAGTAEWMAPEVLRNEPADEKCDVYSYG
VILWELFTLQQPWGKMNPMQVVGAVGFQHRRLDIPEFVDPGIADIIRKCWQTDPRLRPSF
GEIMDSLKQLQKPIQRAAVPSSSALTTDEQEQ

MKVKEETLKNLGDGVVLRPVDHCSSIWSMKMNMKNFLKKLHISPNQSDEAEGSISTTKSN
HHKSIDVSSSSSPRSHHSNSPEIKPFSGLSNWLSSVGHRKIPSPPNSFNAKNRAATVDDT
VVVNGSEHVDLGSKDPAVEEENQIQLALELSAREDPEATQIEAIKQFSLGSCAPENSPAE
LIAYRYWNYNCLGYDDKILDGFYDLYGVLNASSAERIPPLLDLQGTPVSDGVTWEAVLVN
RSGDSNLLRLEQMALDIAAKSRSVSSSGFVNSELVRKLAILVGDYMGGPVVHPESMLRAW
RSLSYSLKATLGSMVLPLGSLTIGLARHRALLFKVLCDSVGVPCRIVKGQQYTGSEDVAM
NFIKADDGREYIVDLMGDPGTLIPADAAGLQIDYDESAYSASPGDNDSIHVASSSNGIES
SYEENTEFRTGEHRSSTKSSGERNQSGGGGDLIVHPNISREDVKNQKKVEKAPFQNLSSR
PIHSFTHMRSPSWTEGVSSPAAQRMKVKDVSQYMIDAAKENPRLAQKLHDVLLESGVVAP
PNLFSEVYPQQLEATVESKNSTEAKKERGKDLETTQEGRHQNGFGPVRFLPPLPRVQSKT
NAHDQRDNGKVVSQSDSSHSEASSTEYARTVPAAVAAAAVVASSMVAAAAAKSANSDSSP
IELPAAAAATATAAAVVATAAAVSRQLELGSNSDGDDGSGGHEPQGSGDSNHGPNSGGER
ISDKSIGNESSKSDCDDVSDCEILWEEITVGERIGLGSYGEVYRGDWHGTEVAVKKFLDQ
DLTGEALEEFRSEVRIMKKLRHPNIVLFMGAVTRPPNLSIVTEFLPRGSLYRLIHRPNNQ
LDERRRLRMALDAARGMNYLHSCNPMIVHRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTY
LSSKSTAGTAEWMAPEVLRNEPADEKCDVYSYGVILWELFTLQQPWGKMNPMQVVGAVGF
QHRRLDIPDFVDPAIADLISKCWQTDSKLRPSFAEIMASLKRLQKPVTGSNIPRPVPSSS
SLPTEHEQKD

Other information
Ka divergence:-0.036808KaKs divergence:-0.245477
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):2979Length 2 (bp):3093Length divergence:0.019
MFE 1 (kcal):-958.57MFE 2 (kcal):-963.7MFE divergence0.003