Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18170-AT1G73655
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):FKBP-like peptidyl-prolyl cis-trans isomerase family protein
Function (paralog2):FKBP-like peptidyl-prolyl cis-trans isomerase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.7768728041921
Log2 mRNA fold difference:1.4203281560755
Log2 TE fold difference:0.32774570295966
Sequences
Protein sequence

MANLFTATAPFLSLSKPFTKTASYHQCYASSSNPPEPESSSPPPPPPPPQPLASQQKRKK
NVETTDWVASSLTRRFGIGAGLAWAGFLAFGVISEQIKTRIEVSQEVANTRDVEEEKEIV
LPNGIRYYDQRVGGGATPRAGDLVVIDLKGQVQGTGQVFVDTFGTKDKKKMKPLALVVGS
KPYSKGLCEGIDYVLRSMKAGGKRRVIVPPSLGFGVDGAELESGLQIPPNASLEYIVEID
RVSIAPA

MATLFTATVPSHHRFVSPSQHPKQSLLSQSLSVTFTENPQPTAVVTLQEQQLTDWITSPV
TRRFGIGAGFTWAGFLAFGVVSEQMKKSRLDVFQEEDNTRGLEKQEEIILPNGIRYYDLQ
VGSGATPSSGYLVVFDVKGQVHGTEQVFVDTFGGKGKSLAMVMDSRPYSKGLCQGIEHVL
RSMKAGGKRRVIIPPSLGFGDRNVEFGQGLEIPPSATLDYIIEVDTVYCFQTIV

Other information
Ka divergence:0.368276KaKs divergence:0.544762
GC content 1 (%):49GC content 2 (%):46GC content divergence:-0.032
Length 1 (bp):744Length 2 (bp):705Length divergence:-0.027
MFE 1 (kcal):-237.8MFE 2 (kcal):-223.44MFE divergence-0.031