Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18180-AT1G73650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1295)
Function (paralog2):Protein of unknown function (DUF1295)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.8337847891571
Log2 mRNA fold difference:3.9135890584831
Log2 TE fold difference:-1.0822748805741
Sequences
Protein sequence

MVKVIDSHYLAITAIVTVGYQFIFFVITALFKFDQVTDFAGSTNFVILAVLTLLLKGTWH
YRQIVLTVLVVVWGLRLGLFLLMRILQWGEDRRFDDMRENIGKLVVFWIFQAVWVWTVSL
PVTFVNASNGGRLFQPADVIGWTMWVAGFLIEATADQQKLSFKKCPENKGKWCDVGVWKY
SRHPNYFGEMLLWWGLYVASLPVLKGLEYLVIIGPVFLTLLLLFVSGIPLLEESADKKYG
NLGAYRHYKKTTSPLILLPRGVYGYLPIWCKSVFLFEFPLYSRNLPQETTAWDRRNSKKS
QRSID

MGTVLDSHFLALTAIVTVIYQFIFFVITALFKFDQVTDFAGSTNFVILAVLTLVLKASWH
FRQIVLTLLVVVWGLRLGIFLLMRILQWGEDRRFDEQRGNIVRLIIFWTLQAVWVWTVSL
PLTLVNASDGGGSLKPADVIGWTMWVFGFLIEAAADQQKLSFKNSPENRGKWCDVGVWKY
SRHPNYFGEMLLWWGIFVAASPVLEGAEYLVIFGPLFLTLLLLFVSGIPLLEASADKKHG
NSGAYRSYKKTTSPLILFPRGVYGNLPGWFKTVFLFEFPFYSRNLPQEGRLQNSKEKEVK
DD

www.000webhost.com

Other information
Ka divergence:-0.238346KaKs divergence:0.0757856
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):918Length 2 (bp):909Length divergence:-0.005
MFE 1 (kcal):-265.2MFE 2 (kcal):-276.2MFE divergence0.02