Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18200-AT1G73640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RAB GTPase homolog A6B
Function (paralog2):RAB GTPase homolog A6A

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.4002488146611
Log2 mRNA fold difference:1.7446994570386
Log2 TE fold difference:0.60826705323369
Sequences
Protein sequence

MAEESYDEECDYLFKAVLIGDSAVGKSNLLSRFSRDEFRLDSKPTIGVDFAYRNVRVGDK
TIKAQIWDTAGQERFRAITSSYYRGALGALLIYDITRRITFKNIEKWLSELRGFSSPETV
VVLVGNKSDLGQSREVEEEEGKTLAESEGLYFLETSALENQNVEEAFLSMIGRIHEVLTQ
KIVLDNRLNGDGNNESNGAVVPPGKEIVNIHEVTATRPLSTSLSNCCYK

MAEDTYEEECDYLFKAVLIGDSAVGKSNLLSRFSKDEFRFDSKPTIGVEFAYRNVHVGDK
IIKAQIWDTAGQERFRAITSSYYRGALGALLIYDITRRTTFDNIKKWLFELRDFANPETV
VVLVGNKSDLRQSREVEEDEGKTLAESEGLYFLETSALENVNVEEAFLVMIGRIHEVVTQ
RIASENKSNGAATPHINGNGNGTVLPVGKEIVNIHEVTATQPLLSSSSNCCFK

Other information
Ka divergence:0.0562022KaKs divergence:-0.999879
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):690Length 2 (bp):702Length divergence:0.009
MFE 1 (kcal):-217.9MFE 2 (kcal):-209.2MFE divergence-0.02