Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18210-AT1G73630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Calcium-binding EF-hand family protein
Function (paralog2):EF hand calcium-binding protein family

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.3494862111498
Log2 mRNA fold difference:-1.9996618921215
Log2 TE fold difference:-0.35124945805322
Sequences
Protein sequence

MASANPETAKPTPATVDMANPEELKKVFDQFDSNGDGKISVLELGGVFKAMGTSYTETEL
NRVLEEVDTDRDGYINLDEFSTLCRSSSSAAEIRDAFDLYDQDKNGLISASELHQVLNRL
GMSCSVEDCTRMIGPVDADGDGNVNFEEFQKMMTSSSLLNSNGSAAPPST

MANTNLESTNKSTTPSTDMELKKVFDKFDANGDGKISVSELGNVFKSMGTSYTEEELNRV
LDEIDIDCDGFINQEEFATICRSSSSAVEIREAFDLYDQNKNGLISSSEIHKVLNRLGMT
CSVEDCVRMIGHVDTDGDGNVNFEEFQKMMSSPELVKGTVANS

www.000webhost.com

Other information
Ka divergence:0.233918KaKs divergence:-0.6168
GC content 1 (%):52GC content 2 (%):43GC content divergence:-0.095
Length 1 (bp):513Length 2 (bp):492Length divergence:-0.021
MFE 1 (kcal):-164.6MFE 2 (kcal):-141.02MFE divergence-0.077