Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18250-AT1G73620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pathogenesis-related thaumatin superfamily protein
Function (paralog2):Pathogenesis-related thaumatin superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.9980351308432
Log2 mRNA fold difference:-1.6623758166187
Log2 TE fold difference:-0.11141986316924
Sequences
Protein sequence

MASINLFLFAFLLLLSHASAASTVIFYNKCKHPVWPGIQPSAGQNLLAGGGFKLPANKAH
SLQLPPLWSGRFWGRHGCTFDRSGRGHCATGDCGGSLSCNGAGGEPPATLAEITLGPELD
FYDVSLVDGYNLAMSIMPVKGSGQCSYAGCVSDLNQMCPVGLQVRSRNGKRVVACKSACS
AFNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCP
HHRH

MTNEKCEVALPLKLKSEKPSMASSSSLFLLPLLLLVSQASASTVIFYNKCTYTVWPGIQP
SSGQSLLAGGGFKLSPNRAYTLQLPPLWSGRFWGRHGCSFDRSGRGRCATGDCGGSFLCN
GAGGVPPATLAEITLGHDMDFYDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPV
GLQVRSRDGTQVVACKSACSAFNSPRYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAY
DDPTSIATCSKANYVVTFCPHRGR

Other information
Ka divergence:0.0228919KaKs divergence:-0.929005
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):735Length 2 (bp):795Length divergence:0.039
MFE 1 (kcal):-211.69MFE 2 (kcal):-263.41MFE divergence0.109