Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18260-AT1G73570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):HCP-like superfamily protein
Function (paralog2):HCP-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-3.2105429851382
Log2 mRNA fold difference:-4.3780686527993
Log2 TE fold difference:1.1841122067109
Sequences
Protein sequence

MRILSYGIVILSLLVFSFIEFGVHARPVVLVLSNDDLNSGGDDNGVGESSDFDEFGESEP
KSEEELDPGSWRSIFEPDDSTVQAASPQYYSGLKKILSAASEGNFRLMEEAVDEIEAASS
AGDPHAQSIMGFVYGIGMMREKSKSKSFLHHNFAAAGGNMQSKMALAFTYLRQDMHDKAV
QLYAELAETAVNSFLISKDSPVVEPTRIHSGTEENKGALRKSRGEEDEDFQILEYQAQKG
NANAMYKIGLFYYFGLRGLRRDHTKALHWFLKAVDKGEPRSMELLGEIYARGAGVERNYT
KALEWLTLAAKEGLYSAFNGIGYLYVKGYGVDKKNYTKAREYFEKAVDNEDPSGHYNLGV
LYLKGIGVNRDVRQATKYFFVAANAGQPKAFYQLAKMFHTGVGLKKNLEMATSFYKLVAE
RGPWSSLSRWALEAYLKGDVGKALILYSRMAEMGYEVAQSNAAWILDKYGERSMCMGVSG
FCTDKERHERAHSLWWRASEQGNEHAALLIGDAYYYGRGTERDFVRAAEAYMHAKSQSNA
QAMFNLGYMHEHGQGLPFDLHLAKRYYDESLQSDAAARLPVTLALASLWLRRNYADTVLV
RVVDSLPEVYPKVETWIENVVFEEGNATILTLFVCLITILYLRERQRRQVVVVADPVAAD
VAQPLDADVAQHLAAFPR

MRVSGQSIIAISLFTLSLYIHRVQARPFVLVLSNEDLNGGFNDNGAYESSDFDEFGESEP
KSEEELDPGSWRRIFETNESTVHASASPQYYSGLHKILSAASEGNTTLMEEAVSEIDSSA
SSGDPHAQSVMGFVYGIGMMRETSRSKSILHHHFAAAGGNMQSKMALAFRYLRQNMYDKA
VELYAELAETAVNSFLISKDSPMAEPVRIHIGTEENKDALRKSRGEEDEDFQILEYQAEK
GNSVAMHKIGLFYYFGLRGLRRDHAKALYWFSKAEFNGLGYLYVKGYGVDKRNYTKAREY
FEMAANNEDPSGHYNLGVLYLKGTGVKKDVRHATKYFFVAANAGQPKAFYQLAKMFHTGV
GLTKNLEMATTFYKLVAERGPWSSLSRWALEAYLKGDVGKAFILYSRMSELGYEVAQSNA
AWIVDKYGERSMCMGVYGFCTDKERHDRAHSLWWRASEQGNEHAALLIGDAYYYGRGTER
DFVRAAEAYMYAKSQSNAQAMFNLGYMHEHGEGLPFDLHLAKRYYDQALQSDTAAKLPVT
LALASVWVRRNYADTALVQVLNSLPEVHQKVVEWVENGMLEEVVLDPVGANVAQPLAAPV
AFPQ

Other information
Ka divergence:0.390046KaKs divergence:0.179487
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):2037Length 2 (bp):1815Length divergence:-0.058
MFE 1 (kcal):-647.15MFE 2 (kcal):-575.22MFE divergence-0.059