Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18300-AT1G73540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nudix hydrolase homolog 4
Function (paralog2):nudix hydrolase homolog 21

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.7408306692774
Log2 mRNA fold difference:1.9153056532434
Log2 TE fold difference:-0.10871954020638
Sequences
Protein sequence

MTGFSVSLFVSNLSNVASYLSPIFENIPSTKVVPAQIEKVVSLVSRTGRDLQRYDHAGYR
QVVGCVPYRYKKQEVNGVETQVIQVLLVSAQKGKGMLFPKGGWETDESMEEAALRETIEE
AGVTGELEEKLGKWQYKSKRHSIIHDGYMFALLVSQEFERWPEAEMRQRRWVSLDEAREV
CQNWWMREALEAFINLKCLADDDESGN

MISLFISNFSNLSNLSPTFDNMNMNIPSKKIVPVPTPSEKVVSLVSRTGRDLQRYNTAGY
RQVVGCVPYRYKKHGGGEIEVLLISAQKKGKGMLLPKGGWEIDESIEEAALRETIEEAGV
TGQLEESLGKWQYKSKRHTMIHDGHMFPLLVSQQFEIWPESEFRQRKWVSLSEAIELCQN
SWMREALEAFINRKCQTQ

www.000webhost.com

Other information
Ka divergence:0.370483KaKs divergence:0.163149
GC content 1 (%):45GC content 2 (%):40GC content divergence:-0.059
Length 1 (bp):624Length 2 (bp):597Length divergence:-0.022
MFE 1 (kcal):-185.3MFE 2 (kcal):-158.05MFE divergence-0.079