Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18350-AT1G73500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):MAP kinase kinase 7
Function (paralog2):MAP kinase kinase 9

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.4158805904318
Log2 mRNA fold difference:2.4460553627828
Log2 TE fold difference:0.523182787106
Sequences
Protein sequence

MALVRKRRQINLRLPVPPLSVHLPWFSFASSTAPVINNGISASDVEKLHVLGRGSSGIVY
KVHHKTTGEIYALKSVNGDMSPAFTRQLAREMEILRRTDSPYVVRCQGIFEKPIVGEVSI
LMEYMDGGNLESLRGAVTEKQLAGFSRQILKGLSYLHSLKIVHRDIKPANLLLNSRNEVK
IADFGVSKIITRSLDYCNSYVGTCAYMSPERFDSAAGENSDVYAGDIWSFGVMILELFVG
HFPLLPQGQRPDWATLMCVVCFGEPPRAPEGCSDEFRSFVDCCLRKESSERWTASQLLGH
PFLRESL

MALVRERRQLNLRLPLPPISDRRFSTSSSSATTTTVAGCNGISACDLEKLNVLGCGNGGI
VYKVRHKTTSEIYALKTVNGDMDPIFTRQLMREMEILRRTDSPYVVKCHGIFEKPVVGEV
SILMEYMDGGTLESLRGGVTEQKLAGFAKQILKGLSYLHALKIVHRDIKPANLLLNSKNE
VKIADFGVSKILVRSLDSCNSYVGTCAYMSPERFDSESSGGSSDIYAGDIWSFGLMMLEL
LVGHFPLLPPGQRPDWATLMCAVCFGEPPRAPEGCSEEFRSFVECCLRKDSSKRWTAPQL
LAHPFLREDL

Other information
Ka divergence:-0.411446KaKs divergence:-0.50618
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):924Length 2 (bp):933Length divergence:0.005
MFE 1 (kcal):-313.88MFE 2 (kcal):-315.58MFE divergence0.003