Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18360-AT1G73480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.70500136736044
Log2 mRNA fold difference:-1.6926941976503
Log2 TE fold difference:1.1967141920339
Sequences
Protein sequence

MICSSKGTVVIATRSSFPRLLNRIQNRNDVPISVIATRRSSMSVEAFPMRLKSSQKKRKM
NIGCGVSPSSPTTTVVDEEVAIRRKLAMRRVLEDNGGDGSSVRDFSLFTTKRGDTLFTQS
WTPVDSAKNRGLVVLLHGLNEHSGRYSDFAKQLNVNGFKVYGIDWIGHGGSDGLHAYVPS
LDYAVADLKSFIEKVIAENPGLPCFCIGHSTGGAIILKAMLDAKIEARVSGIVLTSPAVG
VQPTYPIFGVIAPFLSFLIPRYQLSAAKKKIMPVSRDPEALLAKYSDPLVYTGFIRARTG
NEILRLGAHLLQNLNRIKVPFLVMHGTADTVTDPKGTQKLYNEASSSDKSIKLYDGLLHD
LLFEPERETIAGVILDWLNRRV

MICSSKGTILIARGKNSNTIPRLPLKGSSTNYANRIQIRNPISVKTFRRSSSSSMAVETM
SMGSDSSTLILTSGASGRVRVLFSMRELKRLVTIIQSLILFLLLPFRVVVWRRRTGAVVI
RDDKQERKVWSPPQIVVRKRNIGGESSVSPPSVPAAVVDGEVAVRRELAIKRVLEDEGGD
GSSVRDYSLFTTKRGDTLFSQSWSPLSPNHRGLIVLLHGLNEHSGRYSDFAKQLNANGFK
VYGIDWIGHGGSDGLHAYVPSLDYAVTDLKSFLEKVFTENPGLPCFCFGHSTGGAIILKA
MLDPKIESRVSGIALTSPAVGVQPSHPIFAVLAPIMAFLLPRYQISAANKKGMPVSRDPA
ALIAKYSDPLVFTGSIRVKTGYEILRITAHLQQNLNKVKVPFLVMHGTDDTVTDPSASKK
LYEEAASSDKSLKLYDGLLHDLLFEPEREIIAGAILDWLNQRV

www.000webhost.com

Other information
Ka divergence:-0.107249KaKs divergence:-0.075184
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):1149Length 2 (bp):1392Length divergence:0.096
MFE 1 (kcal):-352.04MFE 2 (kcal):-451.4MFE divergence0.124