Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18400-AT1G73830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):BR enhanced expression 1
Function (paralog2):BR enhanced expression 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-3.2250301261215
Log2 mRNA fold difference:-2.1243296957605
Log2 TE fold difference:-0.99200474174269
Sequences
Protein sequence

MANFENLSSDFQTIAMDIYSSITQAADLNNNNSNLHFQTFHPSSTSLESLFLHHHQQQLL
HFPGNSPDSSNNFSSTSSFLHSDHNIVDETKKRKALLPTLSSSETSGVSDNTNVIATETG
SLRRGKRLKKKKEEEDEKEREVVHVRARRGQATDSHSLAERVRRGKINERLRCLQDMVPG
CYKAMGMATMLDEIINYVQSLQNQVEFLSMKLTAASSFYDFNSETDAVDSMQRAKARETV
EMGRQTRDGSPVFHLSTWSL

MANLSSDFQTFTMDDPIRQLAELSNTLHHFQTFPPPFSSSLDSLFFHNQFPDHFPGKSLE
NNFHQGIFFPSNIQNNEESSSQFDTKKRKSLMEAVSTSENSVSDQTLSTSSAQVSINGNI
STKNNSSRRGKRSKNREEEKEREVVHVRARRGQATDSHSIAERVRRGKINERLKCLQDIV
PGCYKTMGMATMLDEIINYVQSLQNQVEFLSMKLTAASSYYDFNSETDAVESMQKAKARE
AVEMGQGRDGSSVFHSSSWTL

Other information
Ka divergence:-0.255388KaKs divergence:-0.10248
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):783Length 2 (bp):786Length divergence:0.002
MFE 1 (kcal):-216.87MFE 2 (kcal):-222.51MFE divergence0.013