Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18410-AT1G73860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):P-loop containing nucleoside triphosphate hydrolases superfamily protein
Function (paralog2):P-loop containing nucleoside triphosphate hydrolases superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.1791246912353
Log2 mRNA fold difference:1.7527931634585
Log2 TE fold difference:0.42956897519237
Sequences
Protein sequence

MLESEFQREHAFESATEQELTCPISDNLHESVEADDDSVQMLDNLTLNTNPAESCESEEI
QTKALPSSSSGQDLVASDEDSEDVELGDTFYSCSELLQRNCCVLPYKAQKKTKENPFDFD
VRTWSSPCDFPRFGEMILLSPVLNPMPFFSCCTKRAIFCSSPGSSHGGSTPRSPFSPSSP
RERHNKGLADSRFQRPLPNSSALDPSSPGSMLHGGHKSHEAFQMKQGRFDLQAAKISELM
KSNNLDNAPTQSLLSIVNGILDETIERKNGELPQRVACLLRKVVQEIERRISTQSEHLRT
QNSVFKAREEKYQSRIKVLETLASGTSEENETEKSKLEEKKKDKEEDMVGIEKENGHYNL
EISTLRRELETTKKAYEQQCLQMESKTKGATAGIEDRVKELEQMRKDASVARKALEERVR
ELEKMGKEADAVKMNLEEKVKELQKYKDETITVTTSIEGKNRELEQFKQETMTVTTSLEA
QNRELEQAIKETMTVNTSLEAKNRELEQSKKETMTVNTSLKAKNRELEQNLVHWKSKAKE
MEEKSELKNRSWSQKELSYRSFISFQCQALQELRFYSKSIKQEILKVQDKYTVEFSQLGK
KLLELGDAAANYHEVLTENQKLFNELQELKGNIRVYCRVRPFLRGQGASKTVVEHIGDHG
ELVVLNPTKPGKDAHRKFRFNKVYSPASTQAEVFSDIKPLIRSVLDGYNVCIFAYGQTGS
GKTYTMTGPDGASEEEWGVNYRALNDLFRISQSRKSNIAYEVGVQMVEIYNEQVRDLLSG
ILSTTQQNGLAVPDASMYPVTSTSDVLELMSIGLQNRVVSSTALNERSSRSHSIVTVHVR
GKDLKTGSALYGNLHLVDLAGSERVDRSEVTGDRLKEAQHINKSLSALGDVIFSLASKSS
HVPYRNSKLTQLLQSSLGGRAKTLMFVQLNPDITSYSESMSTLKFAERVSGVELGAAKSS
KDGRDVRELMEQDTIARKDDEIERLHLLKDINYPQRLQKKSLGQSDDFNSEAGDSQLSIE
DDSRFQHDYTRQSRHSVTDGEALASSTDAEYDDETEGSTDAPCAAEGRKPLKISDKPKPV
TPRSNTTTSRPLDKLKQVTMRTTNIAKATSALLSPSSQGMKKTGSASNFLKSPKDSKRWS

MNPMRDQPGSPYGDSTPRSPFSPFSPLSVDDRHRNHADTKTPRSPFSPFSPLSGDERHKS
LAESKFQQALASSGQLDPLSPGSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDN
APTQSLLSVLNGILDESIERKNGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKT
REEKYQSRINVLEALASGTGVEHEIATQQLRQIETEKSMWEEKKKHEEEDMVKLMKQNDQ
HNLEISALKQELETTKRKYEQQYSQIESQTKTEKSKWEEQKKNEEEDMDKLLKENDQFNL
QISALRQELETTRKAYEQQCSQMESQTMVATTGLESRLKELEQEGKVVNTAKNALEERVK
ELEQMGKEAHSAKNALEEKIKQLQQMEKETKTANTSLEGKIQELEQNLVMWKTKVREMEK
KSESNHQRWSQKELSYKSFIDNQSQALLELRSYSRSIKQEILKVQENYTDQFSQLGKKLI
ELSNAAENYHAVLTENRKLFNELQELKGNIRVFCRVRPFLPAQGAANTVVEYVGEDGELV
VTNPTRPGKDGLRQFKFNKVYSPTASQADVFSDIRPLVRSVLDGYNVCIFAYGQTGSGKT
YTMTGPDGSSEEDWGVNYRALNDLFKISQSRKGNISYEVGVQMVEIYNEQVLDLLSDDNS
QKKTLGILSTTQQNGLAVPDASMYPVTSTSDVITLMDIGLQNRAVGSTALNERSSRSHSI
VTVHVRGKDLKTGSVLYGNLHLVDLAGSERVDRSEVTGDRLREAQHINKSLSSLGDVIFS
LASKSSHVPYRNSKLTQLLQTSLGGRAKTLMFVQLNPDATSYSESMSTLKFAERVSGVEL
GAAKTSKEGKDVRDLMEQLASLKDTIARKDEEIERLQHQPQRLQKSMMRRKSIGHTDDIN
SDTGEYSSQSRYSVTDGESLASSAEAEYDERLSEITSDAASMGTQGSIDVTKRPPRISDR
AKSVTAKSSTSVTRPLDKLRKVATRTTSTVAKVTGLTSSSKGLASSSIKKTGSTSSLAKS
SKRWA

www.000webhost.com

Other information
Ka divergence:-0.07773KaKs divergence:0.128205
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):3423Length 2 (bp):3078Length divergence:-0.053
MFE 1 (kcal):-967.66MFE 2 (kcal):-844.7MFE divergence-0.068