Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18450-AT1G73910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):actin-related protein 4
Function (paralog2):actin-related proteins 4A

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.698908837589
Log2 mRNA fold difference:-4.4909394778518
Log2 TE fold difference:1.9280850682312
Sequences
Protein sequence

MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSE
DSKTESEKEKSKRKLYVGSQAMSYRRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMI
DPTEHPMLLAEPPLNTQQQREKAAELMFEKYKVPALFMAKNPVLTSFATGRATSLVVDCG
GGSTTISPVHDGYVLQKAVVSSPLGGEFLTDCLLKSLESKGIKIRPRYSFKRKEVRAGEF
QVEDVDIPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLE
IGADRFKVPDVMFNPSIVQTIPGMEKYAEMIPSVRGLPHMVMESINKCDVDIRRELYSSI
LLAGGTSSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQ
MWFSKSEYEEHGASYIQRKCP

MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAIDGNGMDIDDAANTTEDAKES
DKEKGKRKLYTGSQALNFRRDQMEILSPTKDGIVTDWDMVDNVWDHAFRNCLMIDPTEHP
MLLAEPPLNSQQQREKSGFSTFYRC

Other information
Ka divergence:0.0048216KaKs divergence:-0.647471
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1326Length 2 (bp):438Length divergence:-0.503
MFE 1 (kcal):-413.96MFE 2 (kcal):-118.19MFE divergence-0.556