Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18460-AT1G73920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.092236931026705
Log2 mRNA fold difference:-0.41169448520903
Log2 TE fold difference:0.28156172155402
Sequences
Protein sequence

MQRIVDNALAITKESVKTLTYESLNNIARCINGFSALLLTLLPGKSNVLEGLHGWELRPT
LRGPRLPRWMHNGVSSFNHFIHELSVDSDTSSLDYSSGDDDSDGMSTPPSPLSQSSLRSW
ASLPANYESHWTDWITFIVWWALLPARILLWVPLYLLRLLARRNSRMQPLSPGRYQHSSR
PCFSKAISGKEHDVPNRTTDKRRGVIEDLQLGIEIFIETIFDFFHKAAHLLLSPSETFGI
VLSWFSSSSHSSKGNYGDVSDDEIIQTAILGDNDSSLTERRTTTSLYNTDTRTCQDVITE
LGYPYEAIRVVTSDGYGLLLERIPRRDARKAVYLQHGVMDSSMGWVSNGVVGSPAFAAYD
QGYDVFLGNFRGLVSRDHVKKNISSKDFWRYSINEHATEDIPAMIEKIHEIKTSELKLYQ
PTMEEVVNEDQPYKLCVVSHSLGGAAVLMYVITRKIEEKPHRLSRLILLSPAGFHYDSNM
CFTLMEYTFLFLGPVLSRIVPAFYIPTKFFRMLLNKLARDFHNYPAVGGLVQTLMSYVVG
GDSSNWVGVMGLPHYNMNDMPGISFRVAQHLAQIKHSGKFKMFDYGSSSANMDVYGSPEP
LDLGEFYGLIDVPVDLVAGKKDKVIRPSMVRKHYRVMRDSGVDVSYNEFEYAHLDFTFSH
REELLAYVMSRLLLVEPTQTQTVHKKGMKLKKKMETGKPHL

MQRIVDNALAVTKESVKTVTYESLNNIARCINGVSALLLTLLPGKANILEGLHGWELRPT
FRGPRLPRWMHNGVSSFNEFIHELSVDSDTSSLEYSSGEDSDGPLPPSPSSQSSRLSWAS
TSASSENHWTEWITFILWWLMFPVRILLWIPQYIISLFYKRSSRIPASPRRHQHSSRPRI
SKTNSSKDHDVPNRTTDRRRGVIEDLHLAIEIGIEAIFDFFHKATHLLLSPSEAFAILLS
WFSSSSRSPKENHGEVAYDETVQTATLGDTDPSPTERPVESPTRLYNSMNTDTRTCQDVI
TELGYPYEAIRVITSDGYVLVLERIPRRDARKAVFLQHGVLDSSMGWVSNGVVGSPAFAA
YDQGYDVFLGNFRGLVSRDHVNKNISSKEFWRYSINEHGTEDIPAMIEKIHEIKTTELKL
CQPNIDEEINQEEPYKLCAICHSLGGAAILMYVITRKIKEKPHRLSRLILLSPAGFHEDS
NLGFTIVEYIFLFISPVLARIVPAFYIPTRFFRMLLNKLARDFHNYPALGGLVQTLMSYV
VGGDSSNWVGVLGLPHYNMNDMPAVSFRVAQHLAQIKHTGKFRMYDYGSRSANMEVYGSP
EPLDLGESYKFIDVPVDLVAGRNDKVIRSSMVKKHYNVMRDAEVDVSFNEFEYAHLDFTF
SHREELLRYVMSRLLLVKQTPVQQRQTSQKGMKLKKKKKEGTVV

Other information
Ka divergence:-0.0824703KaKs divergence:-0.0270046
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2106Length 2 (bp):2115Length divergence:0.002
MFE 1 (kcal):-642.27MFE 2 (kcal):-635.45MFE divergence-0.005