Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18470-AT1G73950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transmembrane Fragile-X-F-associated protein
Function (paralog2):Transmembrane Fragile-X-F-associated protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.2990017781844
Log2 mRNA fold difference:-1.5758858671071
Log2 TE fold difference:-0.73613466162683
Sequences
Protein sequence

MSCRRVLKSIQALAAHSLLFCFTLLLVLKLDHTVSSSWWMVFFPLWAFHAVVARGRFSLP
APVAPRNRHWAPCHAVVATPLLVAFELLLCIYLESSYARWPPAVSLKIAFLPLLAFELTI
LVDNLRMCRALMPGDDDSITDDAIWEALPHFWVAISMVFTLAATFFTLLKLSGDVVALGW
WDLFINFGIAECFAFLVCTKWSNPVIHRSSRARETGSSSTSIRYLDWNSGLVVAPEEDRH
QDRWCGLQDIGGHMLKIPVILFQVVLCMYLEGTPERAKDISIPVLFSPLFLLQGLGVLFA
ASKLLEKIVLLLRGEAGPGLYFRFSSSAHDCLGFLHHGSRLLGWWSIDEGSREEQARLYF
DQESGYNTFSGHPPEIVKKMPKEDLAEEVWRLQAALGEQTEITKFSQQEYERLQNEKVLC
RVCFEKDISLVLLPCRHRVLCRTCADKCTTCPICRIDIEKRLSVYDV

MNCWRVLKSVQASVAHCFLFSFTLALVLKLDHSITYSWWVVCLPLWAFHAVVARGRFSLP
APIAPRNRHWAPCHAIVSTPLLIAFELLLCVYLETAYADSPPAVSLKIVFLPLLAFEVII
LVDNARMCRALMPGDEESVNDEAVWEALPHFWVAISMVFFLAATVFTLLKLSGDVAALGW
WDLFINFGIAECFAFLVCTKWSNPVIHRSSRDRETGSSSTNIRYLDWNSGLGVFSEDDRN
QDTCGLQDIGGHIMKIPLIVFQVVLCMHLEGTPEAAKSISVPVLFSPLFLLQGVGVLFAA
SKLIEKVVLLLRGEDDTGLYFRFLSRAHDCLGFLHHGSRLLGWWSIDEGSREEEARLYFD
QESGYNTFCGHPPEIVKKMPKKELAEEVWRLQAALGEQTEITKFSQQEYERLQNEKVLCR
VCFEREISVVLLPCRHRVLCRNCSDKCKKCPFCRITIEERLPVYDV

www.000webhost.com

Other information
Ka divergence:0.053349KaKs divergence:0.0977357
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1404Length 2 (bp):1401Length divergence:-0.001
MFE 1 (kcal):-432.41MFE 2 (kcal):-421.26MFE divergence-0.013