Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18500-AT1G74040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):methylthioalkylmalate synthase-like 4
Function (paralog2):2-isopropylmalate synthase 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.99655296974869
Log2 mRNA fold difference:-0.97156207049162
Log2 TE fold difference:-0.033170462856984
Sequences
Protein sequence

MASSLLRNPNLYSSTTITTTSFLPTFSSKPTPISSSFRFQPSHHRSISLRSQTLRLSCSI
SDPSPLPPHTPRRPRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLA
KLGVDIIEAGFPAASKDDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIERAWDAV
KYAKRPRIHTFIATSDIHLEYKLKKTKAEVIEIARSMVRFARSLGCEDVEFSPEDAGRSE
REYLYEILGEVIKAGATTLNIPDTVGITLPSEFGQLITDLKANTPGIENVVISTHCQNDL
GLSTANTLSGAHAGARQMEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRH
IVMTSKMVEEYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSN
DAGIVLGKLSGRHALKDRLTELGYQLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDE
VFQPEAVWKLLDIQITCGTLGLSTATVKLADADGKEHVACSIGTGPVDSAYKAVDLIVKE
PATLLEYSMNAVTEGIDAIATTRVLIRGSNKYSSTNAITGEEVQRTFSGTGAGMDIVVSS
VKAYVGALNKMMDFKENSATKIPSQKNRVAA

MESSILKSPNLSSPSFGVPSIPALSSSSTSPFSSLHLRSQNHRTISLTTAGKFRVSYSLS
ASSPLPPHAPRRRPNYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKL
GVDIIEAGFPAASKDDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIETAWEAVKY
AKRPRIHTFIATSDIHLKYKLKKSKEEVIEIARNMVRFARSLGCEDVEFSPEDAGRSERE
YLYEILGEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIQNVIISTHCQNDLGL
STANTLSGAHSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIV
MTSKMVEEYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMSPEEIGLERSNDA
GIVLGKLSGRHALKDRLNELGYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSDEVF
QPEAVWKLLDMQITCGTLGLSTSTVKLADSDGKEHVACSVGTGPVDAAYKAVDLIVKEPA
TLLEYSMNAVTEGIDAIATTRVLIRGDNNYSSTNAVTGESVERTFSGTGAGMDIVVSSVK
AYVGALNKMLGFKEHTSTLSKTPLETNEVPA

Other information
Ka divergence:-0.176869KaKs divergence:-0.144342
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):1896Length 2 (bp):1896Length divergence:0
MFE 1 (kcal):-546.1MFE 2 (kcal):-556.13MFE divergence0.009