Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18590-AT1G74100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):sulfotransferase 17
Function (paralog2):sulfotransferase 16

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.4309741721714
Log2 mRNA fold difference:2.7822009368634
Log2 TE fold difference:-0.33672181883548
Sequences
Protein sequence

MESKTINDVVVSESNHELASSSPSEFEKNQKHYQEIIATLPHKDGWRPKDPFVEYGGHWW
LQPLLEGLLHAQKFFKARPNDFFVCSYPKTGTTWLKALTFAIANRSKFDVSTNPLLKRNP
HEFVPYIEIDFPFFPSVDVLKDEGNTLFSTHIPYDLLPESVVKSGCKIVYIWRDPKDTFV
SMWTFAHKERSQQGPVVSIEEAFDKYCQGLSAYGPYLDHVLGYWKAYQANPDQILFLKYE
TMRADPLPYVKRLAEFMGYGFTKEEEEGNVVEKVVKLCSFETLKNLEANKGEKDREDRPA
VYANSAYFRKGKVGDWQNYLTPEMVARIDGLMEEKFKGTGFLSSKS

MESKTTQNGSEVVELTEFEKTQKKYQDFIATLPKSKGWRPDEILTQYGGHWWQECLLEGL
FHAKDHFEARPTDFLVCSYPKTGTTWLKALTYAIVNRSRYDDAANPLLKRNPHEFVPYVE
IDFAFYPTVDVLQDRKNPLFSTHIPNGLLPDSIVNSGCKMVYIWRDPKDTFISMWTFLHK
EKSQEGQLASLEDSFDMFCKGLSVYGPYLDHVLGYWKAYQENPDRILFLRYETMRANPLP
FVKRLAEFMGYGFTDEEEENGVAEKVVKLCSFETLKNLEANKGDKEREDRPAVYANSAYF
RKGKVGDWANYLTPEMAARIDGLVEEKFKDTGLLQHDN

Other information
Ka divergence:-0.00526631KaKs divergence:-0.234694
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1041Length 2 (bp):1017Length divergence:-0.012
MFE 1 (kcal):-314.5MFE 2 (kcal):-315.28MFE divergence0.001