Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18610-AT1G74150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Galactose oxidase/kelch repeat superfamily protein
Function (paralog2):Galactose oxidase/kelch repeat superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.8777077284376
Log2 mRNA fold difference:-2.7256749336422
Log2 TE fold difference:0.84886952393642
Sequences
Protein sequence

MRWERVRQLQQQVGLGESSSGPGKRWGHTCNAIKGGSFLYVFGGYGRDNCQTNQVHVFDA
AKQIWTQPMINGTPPPPRDSHSCTTVGDNLFVFGGTDGVNPLKDLYILDTSSHTWKCPSV
RGEGPEAREGHSATLVGKRLFVFGGCGKSSGINEEIYYNDVYIFNTETFVWKRAVTIGNP
PSARDSHSCSSWKNKLVVIGGEDGHDYYLSDVHILDTDTLIWKELNTSGQLLTPRAGHVT
VSLGRNFFVFGGFTDAQNLYDDLYVLDVDTCIWSKVLTMGEGPSARFSSAGACLDPHKAG
FLVIVGGCNKNLEALDDMFYLQTGLGYDARFDQNVGMLSLKKQLKIKCQEQSHASSLYDK
SLVRINMDHQGRGNFGLNTCQFNEGKMMFQARITESYPVGYTMETMIDGKVLRGVLFSNK
RSSILPADQSFSRKRPAMSNGDQDNRSKISRTLIKDQANAVESKDSQLNGMEAGIDTISN
PLGVNITTVAVAPHETETSVVTSDAKNQDASQLDMGTVNTVNTAPSSVPQVDEASLESRN
AITIDDRANKTGLGES

MRWERVQQVGLGDSSSFGPGKRWGHTCNAIKGGRFLYVFGGFGRDNCLTNQVHVFDAETQ
IWIRPEINGVPPCPRDSHSCTTVGDNLFVFGGTDGTKYLNDVHILDTYSHTWIRPDIRGE
GPRVREAHSAALVDKRLFIFGGCGKSSDSDDEVFYNDLYILNTETYMWKRAVTSGKPPSA
RDSHTCSAWKNKIIVVGGEDLDDYYLSDVHILDTDKFVWKELKTSGQVLTPRAGHVTVAL
ERNLFVFGGFTDSQNLYDDLYVLDLETGVWSKVVAMVEGPSARFSSAAVCLDPYKAGSFF
FVGGCNKNLEPLDDIYYLHTEGRYDVRFHQNPGRSSLRKQMKLKCQGQELTVAKTNIDHG
RENVPLNIGYIDQRKPMFQARVTENAPLGYTIETIIDGKVLRGVLFSNRHSSVRIADSSI
SSRQVERPATSDGDCDHRAKIPRTFSKDPAGSSQQAGPTDPSDDTNKKVADSNDTDTPMI
DTVDANVNMEGTHEAETAAVTIDAKDQDASQLDKGIVNTDPLPVSHDQVNVISTDAAKAD
PGVDSSTRKQEEGTSAEEDANVGPQPQQH

www.000webhost.com

Other information
Ka divergence:0.278058KaKs divergence:0.197039
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1671Length 2 (bp):1710Length divergence:0.012
MFE 1 (kcal):-510.74MFE 2 (kcal):-529.85MFE divergence0.018