Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18620-AT1G74160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0744195342121
Log2 mRNA fold difference:-1.4870856569189
Log2 TE fold difference:0.21443532316236
Sequences
Protein sequence

MELVLFLLGIYWKHNKEELRHCHYREKSSNSLLFVTSSKFRRRRFAGEPSWFQKKIGCMN
GIFQIFDRHHILTSRRKSLTLGNAHVNSINFERDSVDAICQQRSAFQCQDSNLVSSNGLS
EKLTRLSTECSRVSFSSSCSSSSPLSSEVNREVQPEISADDRVIFPESPTSDPVMSQGTG
ARVGLDLRDVVRDSMYREARGLSDVCRQNRREDSPRPYGLKQSRPVDFNESCRALAKLRK
TSHHYYNEVDMKDTSRYYVDSRGKSKSGKKLKELPRLSLDSRDHVDLKSGNKLSESFSRS
SSMNKVSGSPKRPPSVVAKLMGLETLPGSPLSRDRFNMFDDNSDPFARSLRENSLNRSLR
FSPSSPRSLGKDPAASSSSPRWRSSEFVMKPLSSLRYPIEPAPWKQTERNRFSQKQACRS
VKSLSQSMEGKLKDLEVKHSGKDLRALKDILEAMQSKGLFDTRKQQQCSNLEAQRDYELA
DSATSKHDSIDLRNPVIPSNMRGPIVIMKPARLVEKSGIPSSSLIPIHSLSGLNKTCREE
PVNVRRSSTSRKAVKDRSPGNQRAEPCISSDKKSSSRNVMSSQVYKESTSKNSGPASSKL
QQMKPEHDKRSRPPASPSDSSKLRKQISRQPVESTTSPGGRRSRPRDQRSLQQNDGQLSQ
MSNKSRTKIEATLSIENGGKSPSVIEAAKAVVSNLIQNKSSPTFSEDGSSEHPSPVSVLN
AEIYREIEPSPVKIQASEGSVNGSINSGVEHCEEDQWNPAYSFSKTTTSFSPEMNRKKLQ
NVEHLVQKLKRLNSSHDETSQDYIASLCENSDPDTDHRYISEILLASGLLLRDLGSGLTT
FQLHPSGHPINPELFLVIEQTKGCSSSSNEKINRKLVFDAVNEMLGKKLAFVESYVDPWM
KQAKARKKVLSAQNLLKELCSEIEILQKQAKKRSENLLLLEEEEEEEEDFLKCILDEDMA
IQSEKWTDFDDAIPGLVLDMERLLFKDLVKEIVHGEIDRLQGNSRRQKTVLADE

MAAKLLHSLADDSADLQKQIGCMNGIFQIFDRHHVLTGRRKSLTLGNGNAININYERDSV
DTIYQQKETFQDSNIGGNVKEKRRVSTESSRVSFSSSCSSSPSSSEFNRGVQPDASAYDR
ANFQESPTSDPEMTEGNGFSHLGLDLRDVVRDSMYREARGLLSKTPMTREEVVRQSRRED
SPRPYGLKQSTPMDLNESFRVLARLRETSQHYNELGMKDAPRYSVDSHDTLKSRQKLKEL
PRLSLDSRERATRNSSVDPKSSKLSESFSESCSSSSKKRPPSVVAKLMGLETLPGSPLGR
DIHQFGLNKTNISDQNDDPFSRSLREKNLNRAIRFSPSSPRSLGKDPASPRWRNSDFVMK
PLSNTRFPVEPAPWKHADRNRVLQKQASMPVKAKPYEAPNFPPTVYSEMERRLNDLEFKH
SGKDLRALKQILESMQSKGFLDTEKQQQSTNFAVQRDYERENSATSNHAMSSRTRVQSSS
SNQVYQSPIVIMKPAKLVEKAGIPASSLIPIHSLTGIKKIRREKPDDKGTSASNSKRVTK
DCSPGNRRAESCTSSFDKKSDSRNVRSSSKKPQQVSKESASKSSGSVSPRLQQKKLEYDK
RSRPPTPPDSSKSRKPSNQQLVESTSPGGRRRPKGQKSLQQVDDQLSQASNESRTSSHGI
CTQSETEASACVEKSTEADGGKSPSVIEAAKAVVSNLMQNKSSPRFSEDGLSANLSLVAL
EHPSPISVLDASTYRETEPSPVKTQGNVAHDFGDENCEDQWNPAYSFSETTSSFSPEINR
KKLQNVEHLVQKLRRLNSSHDEASQDYIASLCENADPTTDHRYISEILLASGLLLRDLGS
GLTTFQLHPSGHPINPELFFVLEQTKGSSTTHLLHKEESKVLKNEKLNRKLVFDLVNEIL
VEKLASVEATTNPLMKSYAKVTKKAVSAQQLLKELCSAIETQQKQATKRSENFLLEEEDD
FLKSILAEDVTIRSGNWADFSGEMSGLVLDVERLVFKDLVNEIVHAETSRLQAKSGRRRT
LFADQ

Other information
Ka divergence:-0.303635KaKs divergence:-0.101466
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):3045Length 2 (bp):3078Length divergence:0.005
MFE 1 (kcal):-899.61MFE 2 (kcal):-911.5MFE divergence0.007