Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18670-AT1G74330
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.29461087685079
Log2 mRNA fold difference:-0.044411102790604
Log2 TE fold difference:-0.26744080478696
Sequences
Protein sequence

MGCVNSKQTVSVTPAIDHSGVFRDNVCSGSGRIVVEDLPPVTETKLLSWWSKSGKKSSSK
KSGSELGSDFGELSESGRASSNCRSESVSFRLGNLSKYLEAEQVAAGWPAWLSNVAGEAI
HGWVPFRSDAFEKLEKIGQGTYSSVFRARETETGRIVALKKVRFDNFEPESVRFMAREIL
ILRKLNHPNIIKLEGIVTSKLSCSIHLVFEYMEHDLTGLLSSPDIDFTTPQIKCYMKQLL
SGLDHCHARGVMHRDIKGSNLLVNNEGILKVADFGLANFCNASGNKQPLTSRVVTLWYRP
PELLLGATEYGASVDLWSVGCVFAELLIGKPVLQGRTEVEQLHKIFKLCGSPPEDYWKKS
KLPHAMLFKPQQHYDGCLRETLKLKGLSDADINLIETLLSIQPHKRGTASTALVSQYFTS
KPFACDPSSLPVYSPSKEIDAKHREDTTRKKISGNGRRGTESRKPTRKPPAFAKLAPAED
VRHHSQKFQKRNGHSVHNSIDSDSTLFEKMQKPSNHEKDEASHVKNASQGDVPFSGPLQV
SVSSGFAWAKRRKDDICVRSHNRSLSRGHIPNLLGPSPAFSENTDVDSKNNEKEKEEKHG
ERTDSQDREAYEMLKLSMLKKWRQLERPDSFGGSDEYHSQELSLELYQREEKAAKLGHLG
YEDNDEKIEFSGPLLSKSYGVDELLERHERQIRQLVRKSWFQKGKKQGK

MGCVSSKQTVSVTPAIDHSGVFKDNENECSGSGRIVVEDPPRPTLKKLVSWRSRSGKRRS
QKSGSELGSESGRASDSLSFRLGNVSRYLEAEQVAAGWPAWLSNVAGEAIHGWVPLRSDA
FEKLEKIGQGTYSNVFRAVETETGRIVALKKVRFDNFEPESVKFMAREILILRRLNHPNI
IKLEGLITSKLSCNIQLVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRG
VMHRDIKGSNLLLSNEGILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPPELLLGATD
YGASVDLWSVGCVFAELLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKKSKLPHAMLFK
PQQTYDSCLRETLKDLSETEINLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSLP
IYPPSKEIDTKHRDEAARKKISGNGRRGIDPRKPSRKAHSFNRLAPDVRHQTETFQKRIG
HLVHSSIESDARLCGKLQNPLDHKKDEASHVKHASQGDVPFSGPLQVSKSNSFAWAKREK
DDVCVRVHNRSLSRGYIPSLSGHSPAFNGKSDVESKINKDEKEDKTDSRGEESYEMVKRS
MLKQWRQLERPDSFGASDEYHSQELSLGLYQRDEMAKKMGNNLGDGDKIEFSGPLLSQSY
GVDELLERHERNIRKLIRKPWFQKVQDKQKKILLFSSEL

www.000webhost.com

Other information
Ka divergence:-0.206709KaKs divergence:0.303936
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2130Length 2 (bp):2100Length divergence:-0.007
MFE 1 (kcal):-655.81MFE 2 (kcal):-640.39MFE divergence-0.012