Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18690-AT1G74380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Galactosyl transferase GMA12/MNN10 family protein
Function (paralog2):xyloglucan xylosyltransferase 5

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.207706295266
Log2 mRNA fold difference:2.9869666585784
Log2 TE fold difference:1.2698137747303
Sequences
Protein sequence

MFQDGSRSSGSGRGLSTTAVSNGGWRTRGFLRGWQIQNTLFNNIKFMILCCFVTILILLG
TIRVGNLGSSNADSVNQSFIKETIPILAEIPSDSHSTDLAEPPKADVSPNATYTLEPRIA
EIPSDVHSTDLVELPKADISPNATYTLGPRIAEIPSDSHLTDLLEPPKADISPNATYTLG
PKITNWDSQRKVWLNQNPEFPNIVNGKARILLLTGSSPGPCDKPIGNYYLLKAVKNKIDY
CRLHGIEIVYNMANLDEELSGYWTKLPMIRTLMLSHPEVEWIWWMDSDALFTDILFEIPL
PRYENHNLVIHGYPDLLFNQKSWVALNTGIFLLRNCQWSLDLLDAWAPMGPKGKIRDETG
KILTAYLKGRPAFEADDQSALIYLLLSQKEKWIEKVYVENQYYLHGFWEGLVDRYEEMIE
KYHPGLGDERWPFVTHFVGCKPCGSYADYAVDRCFKSMERAFNFADNQVLKLYGFSHRGL
LSPKIKRIRNETVSPLESVDKFDIRRMHMETKP

MGQDGSPAHKRPSGSGGGLPTTTLTNGGGRGGRGGLLPRGRQMQKTFNNIKITILCGFVT
ILVLRGTIGVGNLGSSSADAVNQNIIEETNRILAEIRSDSDPTDLDEPQEGDMNPNATYV
LGPKITDWDSQRKVWLNQNPEFPSTVNGKARILLLTGSPPKPCDNPIGDHYLLKSVKNKI
DYCRLHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFTDILFQI
PLARYQKHNLVIHGYPDLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDE
AGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEM
IEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKLYGFSHR
GLLSPKIKRIRNETVSPLEFVDKFDIRRTPVETKPQN

www.000webhost.com

Other information
Ka divergence:-0.398318KaKs divergence:0.202668
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1542Length 2 (bp):1374Length divergence:-0.058
MFE 1 (kcal):-483.59MFE 2 (kcal):-436.2MFE divergence-0.052