Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18720-AT1G74440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF962)
Function (paralog2):Protein of unknown function (DUF962)

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-5.2567898736424
Log2 mRNA fold difference:-5.0631705964422
Log2 TE fold difference:-0.19501232271231
Sequences
Protein sequence

MSRIMGLFDLEKHFAFYGAYHSNPINILIHIIFVWPIFFSVLLLLHSSTPIFDPSQLGFS
QSLTLDGVLRFNVGFIFALIYALFYIGLDKKSGFVAALMCFSCWVGSSFLAVRLGSSLAL
KVGLASQLLCWTGQFVGHGVFEKRAPALLDNLLQAFLMAPFFVLLEVLQSVFGYEPYPGF
QARVNAKVESDIKEYRAKKQKKNKIT

MSNRIGLLDLEKHFAFYGAYHSNPINIIIHTLFVWPNVFATLLFLYSTPPILDHSQLGFL
KSLTFDGVLRLDIGFTLTVTYAVFYICLDKKSGVLAALLCFSCWIGSSFLAARLGHSLTL
KVGVASQLLCWTGQFLGHGLFEKRAPALLDNLLQAFLMGPFFVLLEVLQSVFGYEPYPGF
KARVDSKIESGIKEWREKKKQQQMKKVT

www.000webhost.com

Other information
Ka divergence:0.148215KaKs divergence:-0.00617538
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):621Length 2 (bp):627Length divergence:0.005
MFE 1 (kcal):-155.75MFE 2 (kcal):-191.52MFE divergence0.103