Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18740-AT1G74450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF793)
Function (paralog2):Protein of unknown function (DUF793)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.2144434469602
Log2 mRNA fold difference:-1.1990411265273
Log2 TE fold difference:0.85073331903527
Sequences
Protein sequence

MPATDFQGSFGRSLLSLRRDQVDSSTVVSGSSSHHEPSTMEVELDSFQRQVAEKFIDLNA
SSNDLLSLEWIGKLLDSFLCCQEEFRAIVFNHRSQISKSPMDRLISDYFERSIKALDVCN
AIRDGIEQIRQWEKLADIVISALDSHRPIGEGQLRRAKKALIDLAIGMLDEKDHPSGTNL
AHRNRSFGRVKDSHHRSIGHFRSLSWSVSRSWSASKQLQALASNLATPRPNDVVASNGLA
VPVYTMTSVLLFVMWVLVAAIPCQDRGLQVNFFVPRHFQWAAPVMSLHDKIVEESKRRDR
KNCCGLLKEIDRIEKSSRLMNELIDSIHFPLNDDKEVEVKQRVDELVQVREALRNGLDPF
ERKVREVFHRIVRSRTESLDSL

MPATEYQRSFGRSFLNLRRDTAVNSVESTTVTPELTQMEAELVSFQRKVAERFIDLNASS
CEDLLSLEWVGKLLDSFLSCQEEFRSIVINHRSMITKPPMDRLVSDYFERSVKALDVCNA
IRDGVEQIRQWQKLIEIVICAFNNNGGGSSGKRPLGEGQFRRARKTLIELAIGMLDEKDS
SSSSVSSQHRNRSFGRNKEQLHHRTIGHFRSLSWSVSRSWSASKQLQAIGNNLATPRASD
ITATNGLIVPVYTMTTVLLFVMWALVAAIPCQDRGLQVHFNVPRNYQWGGSLMSLHDRII
EESKKRERKNTCGLLKEIHQFEKTSRLMNELVDSVQFPLSEEKEMEVRERVEELGKLQEA
LKNGLDPFERKVREVFHRIVRSRTEGLDTVGKHHGSE

Other information
Ka divergence:0.12882KaKs divergence:0.00204499
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1149Length 2 (bp):1194Length divergence:0.019
MFE 1 (kcal):-367.71MFE 2 (kcal):-371.01MFE divergence0.004