Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18800-AT1G74560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NAP1-related protein 2
Function (paralog2):NAP1-related protein 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.5670057885819
Log2 mRNA fold difference:0.92851347100267
Log2 TE fold difference:0.61520624896672
Sequences
Protein sequence

MVTDKSKKAKTEEENVEQIDAELVLSIEKLQEIQDDLEKINEKASDEVLEVEQKYNVIRK
PVYDKRNEIIKTIPDFWLTAFLSHPALGELLTEEDQKIFKYLSSLDVEDAKDVKSGYSIT
FSFNPNPFFEDGKLTKTFTFLEEGTTKITATPIKWKEGKGLANGVNHEKNGNKRALPEES
FFTWFSDAQHKEDVEDEMQDEQVADIIKEDLWPNPLTYFNNDADEEDFDGDDDGDEEEKE
GDSDEDDDEEDEVGEE

MVADKSKKSKIEEKGEEENLEQIDAELVLSIEKLQEIQDDLEKINEKASDEVLEVEQKYN
VIRKPVYDKRNEVIQSIPGFWMTAFLSHPALGDLLTEEDQKIFKYLNSLEVEDAKDVKSG
YSITFHFTSNPFFEDAKLTKTFTFLEEGTTKITATPIKWKEGKGLPNGVNHDDKKGNKRA
LPEESFFTWFTDAQHKEDAGDEIHDEVADIIKEDLWMLMKRILMEMMMVTKREKKTMTMK
RRKMVRNDGSPKITHCWLASITDV

www.000webhost.com

Other information
Ka divergence:0.576703KaKs divergence:0.510742
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):771Length 2 (bp):795Length divergence:0.015
MFE 1 (kcal):-193.82MFE 2 (kcal):-210.16MFE divergence0.04